BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0457 (647 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 120 4e-29 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 120 4e-29 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 120 4e-29 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 120 4e-29 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 26 1.2 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 26 1.2 CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal pe... 25 1.6 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 6.3 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 120 bits (289), Expect = 4e-29 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 179 SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 120 bits (289), Expect = 4e-29 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 179 SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 120 bits (289), Expect = 4e-29 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 179 SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 120 bits (289), Expect = 4e-29 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQ 179 SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQ 188 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/53 (26%), Positives = 20/53 (37%) Frame = +3 Query: 387 KWLRPSLVTRRPYRPYSRGCLSSSWLCLGGKPSCTGTLVRVG*NGVHGGQSPT 545 +W R RR PY G + +W L +C L+ +G G T Sbjct: 117 RWTRSGATGRRQPHPYRAGRVGQTWQRLLSVTTCGLLLLLLGATVCRGANGAT 169 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/53 (26%), Positives = 20/53 (37%) Frame = +3 Query: 387 KWLRPSLVTRRPYRPYSRGCLSSSWLCLGGKPSCTGTLVRVG*NGVHGGQSPT 545 +W R RR PY G + +W L +C L+ +G G T Sbjct: 117 RWTRSGATGRRQPHPYRAGRVGQTWQRLLSVTTCGLLLLLLGATVCRGANGAT 169 >CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal peptidase protein. Length = 247 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 530 RAESNMNDLISEYQQYQDATADDEGSSTRKAEEG 631 RA N+N L + Y Y A+D GS +G Sbjct: 95 RASFNLNPLSNTYTIYTSVLANDSGSELELDADG 128 Score = 23.0 bits (47), Expect = 8.3 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -2 Query: 385 KTPRRYVTHGNLAVIGYPLDKI--RAVFVLN 299 K+P + V H +IG P D+I RA F LN Sbjct: 71 KSPTKPVQHVCKRIIGMPGDRIMTRASFNLN 101 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -2 Query: 427 LYGRRVTNEGRSHFKTPRR 371 L+G + N+G ++KTPR+ Sbjct: 500 LFGDLLKNKGAQNYKTPRQ 518 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,353 Number of Sequences: 2352 Number of extensions: 15062 Number of successful extensions: 33 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -