BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0456 (556 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 55 4e-08 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 53 2e-07 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 52 2e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 52 3e-07 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 52 3e-07 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 52 4e-07 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 52 4e-07 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 52 4e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 51 6e-07 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 51 7e-07 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 51 7e-07 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 51 7e-07 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 51 7e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 50 1e-06 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 50 1e-06 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 50 1e-06 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 50 1e-06 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 50 1e-06 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 50 1e-06 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 50 1e-06 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 50 1e-06 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 50 1e-06 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 50 1e-06 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 50 1e-06 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 50 1e-06 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 50 1e-06 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 50 1e-06 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 50 1e-06 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 50 2e-06 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 50 2e-06 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 50 2e-06 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 50 2e-06 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 50 2e-06 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 50 2e-06 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 50 2e-06 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 49 2e-06 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 49 2e-06 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 49 2e-06 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 49 2e-06 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 49 2e-06 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 49 2e-06 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 49 2e-06 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 49 2e-06 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 49 2e-06 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 49 2e-06 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 49 2e-06 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 49 2e-06 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 49 2e-06 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 49 2e-06 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 49 2e-06 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 49 2e-06 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 49 2e-06 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 49 2e-06 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 49 2e-06 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 49 2e-06 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 49 2e-06 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 49 2e-06 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 49 2e-06 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 49 2e-06 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 49 2e-06 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 49 2e-06 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 49 2e-06 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 49 2e-06 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 49 2e-06 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 49 2e-06 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 58.4 bits (135), Expect = 4e-09 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = -2 Query: 129 LKTGVKFRY*TGPR--RFLLSLVPNSCSPGDPLVLERPPPRWS 7 L G K Y PR R+ +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 12 LTKGSKSWYRAPPRGRRYRVSLISNSCSPGDPLVLERPPPRWS 54 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 55.6 bits (128), Expect = 3e-08 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 RF L L+ NSCSPGDPLVLERPPPRWS Sbjct: 16 RFPLFLISNSCSPGDPLVLERPPPRWS 42 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 54.8 bits (126), Expect = 4e-08 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 ++L S+V NSCSPGDPLVLERPPPRWS Sbjct: 342 QYLHSIVSNSCSPGDPLVLERPPPRWS 368 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 54.4 bits (125), Expect = 6e-08 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 +L+ +V NSCSPGDPLVLERPPPRWS Sbjct: 7 YLIPMVSNSCSPGDPLVLERPPPRWS 32 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.4 bits (125), Expect = 6e-08 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 F+ LV NSCSPGDPLVLERPPPRWS Sbjct: 1 FMCMLVSNSCSPGDPLVLERPPPRWS 26 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 31 ISLISNSCSPGDPLVLERPPPRWS 54 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 54.0 bits (124), Expect = 8e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 R L L+ NSCSPGDPLVLERPPPRWS Sbjct: 31 RILFLDLISNSCSPGDPLVLERPPPRWS 58 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 31 ISLISNSCSPGDPLVLERPPPRWS 54 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 31 ISLISNSCSPGDPLVLERPPPRWS 54 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 31 ISLISNSCSPGDPLVLERPPPRWS 54 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 31 ISLISNSCSPGDPLVLERPPPRWS 54 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 31 ISLISNSCSPGDPLVLERPPPRWS 54 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 32 ISLISNSCSPGDPLVLERPPPRWS 55 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 31 ISLISNSCSPGDPLVLERPPPRWS 54 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL+ NSCSPGDPLVLERPPPRWS Sbjct: 29 ISLISNSCSPGDPLVLERPPPRWS 52 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 53.2 bits (122), Expect = 1e-07 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 96 GPRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 G F++ L NSCSPGDPLVLERPPPRWS Sbjct: 1012 GAHVFVVGLGSNSCSPGDPLVLERPPPRWS 1041 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.2 bits (122), Expect = 1e-07 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +L++V NSCSPGDPLVLERPPPRWS Sbjct: 16 VLTVVSNSCSPGDPLVLERPPPRWS 40 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.8 bits (121), Expect = 2e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 F ++ V NSCSPGDPLVLERPPPRWS Sbjct: 5 FRITAVSNSCSPGDPLVLERPPPRWS 30 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 L SL NSCSPGDPLVLERPPPRWS Sbjct: 12 LKSLTSNSCSPGDPLVLERPPPRWS 36 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 52.4 bits (120), Expect = 2e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 + S V NSCSPGDPLVLERPPPRWS Sbjct: 10 MCSFVSNSCSPGDPLVLERPPPRWS 34 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 LV NSCSPGDPLVLERPPPRWS Sbjct: 24 LVSNSCSPGDPLVLERPPPRWS 45 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 LV NSCSPGDPLVLERPPPRWS Sbjct: 3 LVSNSCSPGDPLVLERPPPRWS 24 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 LV NSCSPGDPLVLERPPPRWS Sbjct: 17 LVSNSCSPGDPLVLERPPPRWS 38 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 52.0 bits (119), Expect = 3e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 R F+L V NSCSPGDPLVLERPPPRWS Sbjct: 34 REFVLR-VSNSCSPGDPLVLERPPPRWS 60 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 52.0 bits (119), Expect = 3e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 L+ + NSCSPGDPLVLERPPPRWS Sbjct: 15 LIKITSNSCSPGDPLVLERPPPRWS 39 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 LV NSCSPGDPLVLERPPPRWS Sbjct: 9 LVSNSCSPGDPLVLERPPPRWS 30 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 R L+++ NSCSPGDPLVLERPPPRWS Sbjct: 792 RVMLVAISSNSCSPGDPLVLERPPPRWS 819 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 R L+ NSCSPGDPLVLERPPPRWS Sbjct: 19 RVRFPLISNSCSPGDPLVLERPPPRWS 45 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 LV NSCSPGDPLVLERPPPRWS Sbjct: 2 LVSNSCSPGDPLVLERPPPRWS 23 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 LV NSCSPGDPLVLERPPPRWS Sbjct: 26 LVSNSCSPGDPLVLERPPPRWS 47 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.0 bits (119), Expect = 3e-07 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 + + L NSCSPGDPLVLERPPPRWS Sbjct: 7 YFIMLASNSCSPGDPLVLERPPPRWS 32 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 LV NSCSPGDPLVLERPPPRWS Sbjct: 26 LVSNSCSPGDPLVLERPPPRWS 47 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.0 bits (119), Expect = 3e-07 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 1/25 (4%) Frame = -2 Query: 78 LSLVP-NSCSPGDPLVLERPPPRWS 7 L LVP NSCSPGDPLVLERPPPRWS Sbjct: 25 LPLVPSNSCSPGDPLVLERPPPRWS 49 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.0 bits (119), Expect = 3e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 ++ L+ NSCSPGDPLVLERPPPRWS Sbjct: 13 IVFLISNSCSPGDPLVLERPPPRWS 37 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 L L NSCSPGDPLVLERPPPRWS Sbjct: 659 LQLASNSCSPGDPLVLERPPPRWS 682 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 52.0 bits (119), Expect = 3e-07 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 ++ + + NSCSPGDPLVLERPPPRWS Sbjct: 15 KYAIDIASNSCSPGDPLVLERPPPRWS 41 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.0 bits (119), Expect = 3e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 + ++ V NSCSPGDPLVLERPPPRWS Sbjct: 5 YFINSVSNSCSPGDPLVLERPPPRWS 30 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L+ NSCSPGDPLVLERPPPRWS Sbjct: 17 LISNSCSPGDPLVLERPPPRWS 38 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 + SL NSCSPGDPLVLERPPPRWS Sbjct: 1 MTSLSSNSCSPGDPLVLERPPPRWS 25 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 ++V NSCSPGDPLVLERPPPRWS Sbjct: 76 TIVSNSCSPGDPLVLERPPPRWS 98 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 ++ +V NSCSPGDPLVLERPPPRWS Sbjct: 3470 YVARVVSNSCSPGDPLVLERPPPRWS 3495 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L+ NSCSPGDPLVLERPPPRWS Sbjct: 8 LISNSCSPGDPLVLERPPPRWS 29 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 93 PRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 P ++ + NSCSPGDPLVLERPPPRWS Sbjct: 18 PCAVIMRITSNSCSPGDPLVLERPPPRWS 46 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 ++ +V NSCSPGDPLVLERPPPRWS Sbjct: 4 MIVVVSNSCSPGDPLVLERPPPRWS 28 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 ++ V NSCSPGDPLVLERPPPRWS Sbjct: 16 IAFVSNSCSPGDPLVLERPPPRWS 39 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L+ NSCSPGDPLVLERPPPRWS Sbjct: 40 LISNSCSPGDPLVLERPPPRWS 61 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +SL NSCSPGDPLVLERPPPRWS Sbjct: 4 VSLSSNSCSPGDPLVLERPPPRWS 27 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L+ NSCSPGDPLVLERPPPRWS Sbjct: 70 LISNSCSPGDPLVLERPPPRWS 91 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +S V NSCSPGDPLVLERPPPRWS Sbjct: 14 VSKVSNSCSPGDPLVLERPPPRWS 37 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 ++V NSCSPGDPLVLERPPPRWS Sbjct: 12 NIVSNSCSPGDPLVLERPPPRWS 34 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 51.6 bits (118), Expect = 4e-07 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +++ + NSCSPGDPLVLERPPPRWS Sbjct: 48 VIAFISNSCSPGDPLVLERPPPRWS 72 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 ++L NSCSPGDPLVLERPPPRWS Sbjct: 1 MTLASNSCSPGDPLVLERPPPRWS 24 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +S+ NSCSPGDPLVLERPPPRWS Sbjct: 17 VSITSNSCSPGDPLVLERPPPRWS 40 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 51.2 bits (117), Expect = 6e-07 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 1/25 (4%) Frame = -2 Query: 78 LSLVP-NSCSPGDPLVLERPPPRWS 7 L L+P NSCSPGDPLVLERPPPRWS Sbjct: 22 LQLLPSNSCSPGDPLVLERPPPRWS 46 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S V NSCSPGDPLVLERPPPRWS Sbjct: 13 SQVSNSCSPGDPLVLERPPPRWS 35 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +L+ NSCSPGDPLVLERPPPRWS Sbjct: 61 TLLSNSCSPGDPLVLERPPPRWS 83 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 LL+ NSCSPGDPLVLERPPPRWS Sbjct: 17 LLAPTSNSCSPGDPLVLERPPPRWS 41 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 L L NSCSPGDPLVLERPPPRWS Sbjct: 32 LKLSSNSCSPGDPLVLERPPPRWS 55 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 F + ++ NSCSPGDPLVLERPPPRWS Sbjct: 29 FGIGVLSNSCSPGDPLVLERPPPRWS 54 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 R L + NSCSPGDPLVLERPPPRWS Sbjct: 145 RNSRLEKISNSCSPGDPLVLERPPPRWS 172 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.2 bits (117), Expect = 6e-07 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +++ NSCSPGDPLVLERPPPRWS Sbjct: 12 NIISNSCSPGDPLVLERPPPRWS 34 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 + L+ NSCSPGDPLVLERPPPRWS Sbjct: 52 IPLLSNSCSPGDPLVLERPPPRWS 75 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +L+ NSCSPGDPLVLERPPPRWS Sbjct: 1 TLLSNSCSPGDPLVLERPPPRWS 23 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 93 PRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 P + NSCSPGDPLVLERPPPRWS Sbjct: 54 PNNLFIITTSNSCSPGDPLVLERPPPRWS 82 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 +V NSCSPGDPLVLERPPPRWS Sbjct: 1 MVSNSCSPGDPLVLERPPPRWS 22 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 L +++ NSCSPGDPLVLERPPPRWS Sbjct: 2 LHNVISNSCSPGDPLVLERPPPRWS 26 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 93 PRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 P + + + NSCSPGDPLVLERPPPRWS Sbjct: 29 PMQHAIPALSNSCSPGDPLVLERPPPRWS 57 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 R L+ NSCSPGDPLVLERPPPRWS Sbjct: 15 RLDLTFTSNSCSPGDPLVLERPPPRWS 41 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 +V NSCSPGDPLVLERPPPRWS Sbjct: 85 IVSNSCSPGDPLVLERPPPRWS 106 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 L L NSCSPGDPLVLERPPPRWS Sbjct: 86 LLLTSNSCSPGDPLVLERPPPRWS 109 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.2 bits (117), Expect = 6e-07 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +++ NSCSPGDPLVLERPPPRWS Sbjct: 3 TIISNSCSPGDPLVLERPPPRWS 25 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 R+ S NSCSPGDPLVLERPPPRWS Sbjct: 9 RYPRSTASNSCSPGDPLVLERPPPRWS 35 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 +V NSCSPGDPLVLERPPPRWS Sbjct: 6 IVSNSCSPGDPLVLERPPPRWS 27 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 51.2 bits (117), Expect = 6e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -2 Query: 93 PRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 P+R ++ V NSCSPGDPLVLERPPPRWS Sbjct: 17 PKR--VNAVSNSCSPGDPLVLERPPPRWS 43 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 +V NSCSPGDPLVLERPPPRWS Sbjct: 1 MVSNSCSPGDPLVLERPPPRWS 22 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.2 bits (117), Expect = 6e-07 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +++ NSCSPGDPLVLERPPPRWS Sbjct: 12 NIISNSCSPGDPLVLERPPPRWS 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 50.8 bits (116), Expect = 7e-07 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 3/26 (11%) Frame = -2 Query: 75 SLVP---NSCSPGDPLVLERPPPRWS 7 SLVP NSCSPGDPLVLERPPPRWS Sbjct: 21 SLVPRPSNSCSPGDPLVLERPPPRWS 46 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.8 bits (116), Expect = 7e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 LS NSCSPGDPLVLERPPPRWS Sbjct: 3 LSTQSNSCSPGDPLVLERPPPRWS 26 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.8 bits (116), Expect = 7e-07 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 17 IISNSCSPGDPLVLERPPPRWS 38 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +L NSCSPGDPLVLERPPPRWS Sbjct: 14 ALTSNSCSPGDPLVLERPPPRWS 36 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 50.8 bits (116), Expect = 7e-07 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 119 IISNSCSPGDPLVLERPPPRWS 140 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S + NSCSPGDPLVLERPPPRWS Sbjct: 57 SSISNSCSPGDPLVLERPPPRWS 79 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 50.8 bits (116), Expect = 7e-07 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 3/34 (8%) Frame = -2 Query: 99 TGPRRFLLS---LVPNSCSPGDPLVLERPPPRWS 7 T RRF S V NSCSPGDPLVLERPPPRWS Sbjct: 104 TFQRRFTASDTNEVSNSCSPGDPLVLERPPPRWS 137 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.8 bits (116), Expect = 7e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 LS NSCSPGDPLVLERPPPRWS Sbjct: 8 LSYQSNSCSPGDPLVLERPPPRWS 31 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 50.8 bits (116), Expect = 7e-07 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -2 Query: 132 VLKTGVKFRY*TGPRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 V + G KFR +R S NSCSPGDPLVLERPPPRWS Sbjct: 49 VEQDGSKFRR----KRRKSSTTSNSCSPGDPLVLERPPPRWS 86 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 ++S + NSCSPGDPLVLERPPPRWS Sbjct: 7 VISELSNSCSPGDPLVLERPPPRWS 31 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S + NSCSPGDPLVLERPPPRWS Sbjct: 2 SQISNSCSPGDPLVLERPPPRWS 24 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.8 bits (116), Expect = 7e-07 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 14 IISNSCSPGDPLVLERPPPRWS 35 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 R+ ++ NSCSPGDPLVLERPPPRWS Sbjct: 31 RQLSITSTSNSCSPGDPLVLERPPPRWS 58 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +L NSCSPGDPLVLERPPPRWS Sbjct: 5 TLASNSCSPGDPLVLERPPPRWS 27 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L+ NSCSPGDPLVLERPPPRWS Sbjct: 6 LLSNSCSPGDPLVLERPPPRWS 27 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.8 bits (116), Expect = 7e-07 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 5 IISNSCSPGDPLVLERPPPRWS 26 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 50.8 bits (116), Expect = 7e-07 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%) Frame = -2 Query: 78 LSLVP-NSCSPGDPLVLERPPPRWS 7 L VP NSCSPGDPLVLERPPPRWS Sbjct: 9 LGFVPSNSCSPGDPLVLERPPPRWS 33 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.8 bits (116), Expect = 7e-07 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 1 MISNSCSPGDPLVLERPPPRWS 22 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 L + NSCSPGDPLVLERPPPRWS Sbjct: 6 LAQITSNSCSPGDPLVLERPPPRWS 30 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S+ NSCSPGDPLVLERPPPRWS Sbjct: 6 SVTSNSCSPGDPLVLERPPPRWS 28 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 ++S NSCSPGDPLVLERPPPRWS Sbjct: 6 VISKTSNSCSPGDPLVLERPPPRWS 30 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L+ NSCSPGDPLVLERPPPRWS Sbjct: 1 LLSNSCSPGDPLVLERPPPRWS 22 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L+ NSCSPGDPLVLERPPPRWS Sbjct: 7 LLSNSCSPGDPLVLERPPPRWS 28 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 +V NSCSPGDPLVLERPPPRWS Sbjct: 27 VVSNSCSPGDPLVLERPPPRWS 48 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S + NSCSPGDPLVLERPPPRWS Sbjct: 4 SKISNSCSPGDPLVLERPPPRWS 26 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 + V NSCSPGDPLVLERPPPRWS Sbjct: 13 IADFVSNSCSPGDPLVLERPPPRWS 37 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.8 bits (116), Expect = 7e-07 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 26 IISNSCSPGDPLVLERPPPRWS 47 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +L NSCSPGDPLVLERPPPRWS Sbjct: 95 ALASNSCSPGDPLVLERPPPRWS 117 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 30 VSNSCSPGDPLVLERPPPRWS 50 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +++ + NSCSPGDPLVLERPPPRWS Sbjct: 511 VVTFLSNSCSPGDPLVLERPPPRWS 535 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 7 VSNSCSPGDPLVLERPPPRWS 27 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 10 VSNSCSPGDPLVLERPPPRWS 30 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 ++ + NSCSPGDPLVLERPPPRWS Sbjct: 12 IVQQISNSCSPGDPLVLERPPPRWS 36 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 R S+ NSCSPGDPLVLERPPPRWS Sbjct: 106 RLKRSVESNSCSPGDPLVLERPPPRWS 132 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S NSCSPGDPLVLERPPPRWS Sbjct: 12 SFTSNSCSPGDPLVLERPPPRWS 34 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +++ NSCSPGDPLVLERPPPRWS Sbjct: 12 NILSNSCSPGDPLVLERPPPRWS 34 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 2 VSNSCSPGDPLVLERPPPRWS 22 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +S NSCSPGDPLVLERPPPRWS Sbjct: 31 ISKTSNSCSPGDPLVLERPPPRWS 54 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +++ + NSCSPGDPLVLERPPPRWS Sbjct: 31 IIASLSNSCSPGDPLVLERPPPRWS 55 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +L++ NSCSPGDPLVLERPPPRWS Sbjct: 7 VLTVGSNSCSPGDPLVLERPPPRWS 31 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 L + NSCSPGDPLVLERPPPRWS Sbjct: 18 LLITSNSCSPGDPLVLERPPPRWS 41 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 RR LS NSCSPGDPLVLERPPPRWS Sbjct: 4 RRLFLS---NSCSPGDPLVLERPPPRWS 28 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 184 VSNSCSPGDPLVLERPPPRWS 204 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 L L NSCSPGDPLVLERPPPRWS Sbjct: 5 LFLPSNSCSPGDPLVLERPPPRWS 28 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 34 VSNSCSPGDPLVLERPPPRWS 54 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 1066 VSNSCSPGDPLVLERPPPRWS 1086 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 14 VISNSCSPGDPLVLERPPPRWS 35 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 78 LTSNSCSPGDPLVLERPPPRWS 99 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 3 VSNSCSPGDPLVLERPPPRWS 23 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 214 VSNSCSPGDPLVLERPPPRWS 234 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 32 VSNSCSPGDPLVLERPPPRWS 52 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 5 LASNSCSPGDPLVLERPPPRWS 26 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 L + NSCSPGDPLVLERPPPRWS Sbjct: 75 LRFLSNSCSPGDPLVLERPPPRWS 98 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 5 VSNSCSPGDPLVLERPPPRWS 25 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 3 VSNSCSPGDPLVLERPPPRWS 23 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 7 VSNSCSPGDPLVLERPPPRWS 27 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 64 VSNSCSPGDPLVLERPPPRWS 84 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 93 PRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 P + + NSCSPGDPLVLERPPPRWS Sbjct: 9 PTTYRMFFQSNSCSPGDPLVLERPPPRWS 37 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 ++ ++ NSCSPGDPLVLERPPPRWS Sbjct: 20 VIHVLSNSCSPGDPLVLERPPPRWS 44 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 11 VSNSCSPGDPLVLERPPPRWS 31 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 25 VSNSCSPGDPLVLERPPPRWS 45 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 15 VSNSCSPGDPLVLERPPPRWS 35 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 L + + NSCSPGDPLVLERPPPRWS Sbjct: 14 LWASISNSCSPGDPLVLERPPPRWS 38 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 17 LASNSCSPGDPLVLERPPPRWS 38 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +++ NSCSPGDPLVLERPPPRWS Sbjct: 2 VTIASNSCSPGDPLVLERPPPRWS 25 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 10 VSNSCSPGDPLVLERPPPRWS 30 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 59 VSNSCSPGDPLVLERPPPRWS 79 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 31 VSNSCSPGDPLVLERPPPRWS 51 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 41 VSNSCSPGDPLVLERPPPRWS 61 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 15 VSNSCSPGDPLVLERPPPRWS 35 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 6 VSNSCSPGDPLVLERPPPRWS 26 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 15 VSNSCSPGDPLVLERPPPRWS 35 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 37 LTSNSCSPGDPLVLERPPPRWS 58 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 18 VSNSCSPGDPLVLERPPPRWS 38 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 84 FLLSLVPNSCSPGDPLVLERPPPRWS 7 F+ + NSCSPGDPLVLERPPPRWS Sbjct: 67 FVTATESNSCSPGDPLVLERPPPRWS 92 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 + + NSCSPGDPLVLERPPPRWS Sbjct: 1 MKITSNSCSPGDPLVLERPPPRWS 24 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/34 (67%), Positives = 26/34 (76%), Gaps = 5/34 (14%) Frame = -2 Query: 93 PRRFLLSL-----VPNSCSPGDPLVLERPPPRWS 7 PR+F + L + NSCSPGDPLVLERPPPRWS Sbjct: 2 PRQFYIFLFCCGELSNSCSPGDPLVLERPPPRWS 35 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 20 LASNSCSPGDPLVLERPPPRWS 41 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 11 LTSNSCSPGDPLVLERPPPRWS 32 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 +R LL + NSCSPGDPLVLERPPPRWS Sbjct: 110 KRRLLG-ISNSCSPGDPLVLERPPPRWS 136 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 30 VSNSCSPGDPLVLERPPPRWS 50 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +S NSCSPGDPLVLERPPPRWS Sbjct: 10 VSYTSNSCSPGDPLVLERPPPRWS 33 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 32 VSNSCSPGDPLVLERPPPRWS 52 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = -2 Query: 162 SWLLKAWLF*VLKTGVKFRY*TGPRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 S +L A VL + + Y R LL+ NSCSPGDPLVLERPPPRWS Sbjct: 13 SLVLLALFIAVLLSALAVSYCAYWNRQLLN-ASNSCSPGDPLVLERPPPRWS 63 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 14 VSNSCSPGDPLVLERPPPRWS 34 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 34 VSNSCSPGDPLVLERPPPRWS 54 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 17 VISNSCSPGDPLVLERPPPRWS 38 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 8 VSNSCSPGDPLVLERPPPRWS 28 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 10 VSNSCSPGDPLVLERPPPRWS 30 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 18 VSNSCSPGDPLVLERPPPRWS 38 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 11 LASNSCSPGDPLVLERPPPRWS 32 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 27 VSNSCSPGDPLVLERPPPRWS 47 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 7 LASNSCSPGDPLVLERPPPRWS 28 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 193 VSNSCSPGDPLVLERPPPRWS 213 >SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 + + NSCSPGDPLVLERPPPRWS Sbjct: 1 MGITSNSCSPGDPLVLERPPPRWS 24 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 V NSCSPGDPLVLERPPPRWS Sbjct: 9 VSNSCSPGDPLVLERPPPRWS 29 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 25 VISNSCSPGDPLVLERPPPRWS 46 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 11 LTSNSCSPGDPLVLERPPPRWS 32 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = -2 Query: 87 RFLLSLVPNSCSPGDPLVLERPPPRWS 7 + +L + NSCSPGDPLVLERPPPRWS Sbjct: 23 KLVLQGLSNSCSPGDPLVLERPPPRWS 49 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 +S NSCSPGDPLVLERPPPRWS Sbjct: 13 ISQTSNSCSPGDPLVLERPPPRWS 36 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 4 LASNSCSPGDPLVLERPPPRWS 25 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 ++ + NSCSPGDPLVLERPPPRWS Sbjct: 6 VIRYISNSCSPGDPLVLERPPPRWS 30 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 12 NIASNSCSPGDPLVLERPPPRWS 34 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 5 ISNSCSPGDPLVLERPPPRWS 25 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 101 ISNSCSPGDPLVLERPPPRWS 121 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 261 ISNSCSPGDPLVLERPPPRWS 281 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 50.0 bits (114), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 99 TGPRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 +GP NSCSPGDPLVLERPPPRWS Sbjct: 32 SGPYYLQKKNASNSCSPGDPLVLERPPPRWS 62 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 36 NIASNSCSPGDPLVLERPPPRWS 58 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +L NSCSPGDPLVLERPPPRWS Sbjct: 22 ALSSNSCSPGDPLVLERPPPRWS 44 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S NSCSPGDPLVLERPPPRWS Sbjct: 12 STASNSCSPGDPLVLERPPPRWS 34 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 21 ISNSCSPGDPLVLERPPPRWS 41 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 93 PRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 P + + NSCSPGDPLVLERPPPRWS Sbjct: 25 PNIWCMRKTSNSCSPGDPLVLERPPPRWS 53 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 + ++ NSCSPGDPLVLERPPPRWS Sbjct: 9 ITKVLSNSCSPGDPLVLERPPPRWS 33 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 9 ISNSCSPGDPLVLERPPPRWS 29 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 10 ISNSCSPGDPLVLERPPPRWS 30 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 3 ISNSCSPGDPLVLERPPPRWS 23 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 55 ILSNSCSPGDPLVLERPPPRWS 76 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 13 ISNSCSPGDPLVLERPPPRWS 33 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 4 ISNSCSPGDPLVLERPPPRWS 24 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 52 ISNSCSPGDPLVLERPPPRWS 72 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 51 ISNSCSPGDPLVLERPPPRWS 71 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 16 ISNSCSPGDPLVLERPPPRWS 36 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 4/30 (13%) Frame = -2 Query: 84 FLLSLVP----NSCSPGDPLVLERPPPRWS 7 F+L L P NSCSPGDPLVLERPPPRWS Sbjct: 60 FILILQPHPRSNSCSPGDPLVLERPPPRWS 89 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 50.0 bits (114), Expect = 1e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +LS NSCSPGDPLVLERPPPRWS Sbjct: 554 ILSDRSNSCSPGDPLVLERPPPRWS 578 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 + L NSCSPGDPLVLERPPPRWS Sbjct: 1 MRLSSNSCSPGDPLVLERPPPRWS 24 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +LSL NSCSPGDPLVLERPPPRWS Sbjct: 1 MLSL-SNSCSPGDPLVLERPPPRWS 24 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 21 ISNSCSPGDPLVLERPPPRWS 41 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 47 ISNSCSPGDPLVLERPPPRWS 67 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 7 ISNSCSPGDPLVLERPPPRWS 27 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 4 ISNSCSPGDPLVLERPPPRWS 24 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 32 ISNSCSPGDPLVLERPPPRWS 52 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 +L+ + NSCSPGDPLVLERPPPRWS Sbjct: 34 VLTGLSNSCSPGDPLVLERPPPRWS 58 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 12 NITSNSCSPGDPLVLERPPPRWS 34 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S + NSCSPGDPLVLERPPPRWS Sbjct: 5 SQLSNSCSPGDPLVLERPPPRWS 27 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 32 ISNSCSPGDPLVLERPPPRWS 52 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 2420 AIASNSCSPGDPLVLERPPPRWS 2442 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 +++ NSCSPGDPLVLERPPPRWS Sbjct: 18 TVLSNSCSPGDPLVLERPPPRWS 40 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 974 ISNSCSPGDPLVLERPPPRWS 994 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 6 ISNSCSPGDPLVLERPPPRWS 26 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 65 MLSNSCSPGDPLVLERPPPRWS 86 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S+ NSCSPGDPLVLERPPPRWS Sbjct: 3 SIGSNSCSPGDPLVLERPPPRWS 25 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 1 ISNSCSPGDPLVLERPPPRWS 21 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 5 ISNSCSPGDPLVLERPPPRWS 25 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 45 TITSNSCSPGDPLVLERPPPRWS 67 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 L NSCSPGDPLVLERPPPRWS Sbjct: 23 LQAASNSCSPGDPLVLERPPPRWS 46 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 32 ISNSCSPGDPLVLERPPPRWS 52 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 2 ISNSCSPGDPLVLERPPPRWS 22 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 2 ISNSCSPGDPLVLERPPPRWS 22 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 14 ISNSCSPGDPLVLERPPPRWS 34 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 2 ISNSCSPGDPLVLERPPPRWS 22 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 8 ISNSCSPGDPLVLERPPPRWS 28 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 + F NSCSPGDPLVLERPPPRWS Sbjct: 4 KSFASCFASNSCSPGDPLVLERPPPRWS 31 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 90 ISNSCSPGDPLVLERPPPRWS 110 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 104 ILSNSCSPGDPLVLERPPPRWS 125 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 81 LLSLVPNSCSPGDPLVLERPPPRWS 7 L++ NSCSPGDPLVLERPPPRWS Sbjct: 11 LVTASSNSCSPGDPLVLERPPPRWS 35 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 7 ISNSCSPGDPLVLERPPPRWS 27 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 93 PRRFLLSLVPNSCSPGDPLVLERPPPRWS 7 P+ L L NSCSPGDPLVLERPPPRWS Sbjct: 16 PKHHFL-LPSNSCSPGDPLVLERPPPRWS 43 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 12 ILSNSCSPGDPLVLERPPPRWS 33 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 68 ISNSCSPGDPLVLERPPPRWS 88 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 30 ISNSCSPGDPLVLERPPPRWS 50 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 46 ISNSCSPGDPLVLERPPPRWS 66 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 45 ISNSCSPGDPLVLERPPPRWS 65 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 591 ISNSCSPGDPLVLERPPPRWS 611 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPPPRWS 7 S+ NSCSPGDPLVLERPPPRWS Sbjct: 33 SIRSNSCSPGDPLVLERPPPRWS 55 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 50.0 bits (114), Expect = 1e-06 Identities = 21/27 (77%), Positives = 24/27 (88%), Gaps = 1/27 (3%) Frame = -2 Query: 84 FLLSLVP-NSCSPGDPLVLERPPPRWS 7 F ++L+ NSCSPGDPLVLERPPPRWS Sbjct: 140 FSINLITSNSCSPGDPLVLERPPPRWS 166 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 4 ISNSCSPGDPLVLERPPPRWS 24 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 12 ISNSCSPGDPLVLERPPPRWS 32 >SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -2 Query: 90 RRFLLSLVPNSCSPGDPLVLERPPPRWS 7 RR +S NSCSPGDPLVLERPPPRWS Sbjct: 36 RRLQIS-TSNSCSPGDPLVLERPPPRWS 62 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPPPRWS 7 + NSCSPGDPLVLERPPPRWS Sbjct: 10 ISNSCSPGDPLVLERPPPRWS 30 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LSLVPNSCSPGDPLVLERPPPRWS 7 ++ NSCSPGDPLVLERPPPRWS Sbjct: 6 ITTTSNSCSPGDPLVLERPPPRWS 29 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,700,223 Number of Sequences: 59808 Number of extensions: 280502 Number of successful extensions: 2162 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2161 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -