Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0443
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8IC25 Cluster: Putative uncharacterized protein MAL7P1...    38   0.24 

>UniRef50_Q8IC25 Cluster: Putative uncharacterized protein
           MAL7P1.18; n=4; Plasmodium|Rep: Putative uncharacterized
           protein MAL7P1.18 - Plasmodium falciparum (isolate 3D7)
          Length = 1587

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = -3

Query: 350 KELKLMTIKNKKQMCRP*RQNIKRLKKPFIPIYRNAEVKTLILLNISLCFDLYKNMC 180
           ++LK   ++ +K+       N+K+ K+P   +Y N      + +N ++C D+YKN+C
Sbjct: 705 RKLKEHRVRIRKKYIEDIEPNVKKKKEP---LYENVNENLCVHMNKNICVDMYKNIC 758


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 440,052,281
Number of Sequences: 1657284
Number of extensions: 6445991
Number of successful extensions: 12085
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11895
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12083
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)