BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0441 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 24 3.2 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 5.7 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 5.7 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 5.7 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 5.7 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 5.7 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 5.7 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 5.7 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 5.7 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 5.7 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 5.7 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 5.7 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 5.7 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 5.7 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 23 5.7 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 23 5.7 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 23 5.7 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 23 5.7 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 23 5.7 AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-tran... 23 5.7 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 9.9 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 23 9.9 AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha su... 23 9.9 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 23 9.9 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 23 9.9 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 23 9.9 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 23 9.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 9.9 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +3 Query: 81 GQGSRTRVVLSEIQQRCFSVSPLTAAAAQVAMSKFDKVPLXYEKLT 218 G+G R V++EI + + L + ++ KF+++ ++KLT Sbjct: 225 GEGQRLVDVVNEIFCLTYQLDVLPSVWKYISTPKFNRLMKLFDKLT 270 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 190 LSNLDIATWAAAAVNGDTLKHL 125 L+ +D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-transferase E6 protein. Length = 227 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 266 SEKILYSHLDDPKGQEIERGASYLRLXPD 352 S+ +LY+H P G+ +E L L D Sbjct: 3 SKPVLYTHTISPAGRAVELTVKALNLDVD 31 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 263 LSEKILYSHLDD 298 L EKI+YSHL D Sbjct: 273 LEEKIMYSHLVD 284 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 263 LSEKILYSHLDD 298 L EKI+YSHL D Sbjct: 130 LEEKIMYSHLVD 141 >AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha subunit AgGq5 protein. Length = 127 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 263 LSEKILYSHLDD 298 L EKI+YSHL D Sbjct: 87 LEEKIMYSHLVD 98 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 263 LSEKILYSHLDD 298 L EKI+YSHL D Sbjct: 87 LEEKIMYSHLVD 98 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 263 LSEKILYSHLDD 298 L EKI+YSHL D Sbjct: 86 LEEKIMYSHLVD 97 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 263 LSEKILYSHLDD 298 L EKI+YSHL D Sbjct: 87 LEEKIMYSHLVD 98 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 263 LSEKILYSHLDD 298 L EKI+YSHL D Sbjct: 86 LEEKIMYSHLVD 97 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 22.6 bits (46), Expect = 9.9 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 102 VVLSEIQQRCFSVSP---LTAAAAQVAMSKFD 188 VVLS+I Q C+ SP LTA + + K + Sbjct: 526 VVLSKIMQECWHPSPAVRLTALRVKKTLVKLE 557 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,528 Number of Sequences: 2352 Number of extensions: 11884 Number of successful extensions: 59 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -