BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0440 (522 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) 126 1e-29 SB_50092| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=2.1e-33) 31 0.76 SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) 29 2.3 SB_58733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_30920| Best HMM Match : DUP (HMM E-Value=4.6) 28 5.4 SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_2066| Best HMM Match : Dynein_heavy (HMM E-Value=0) 27 7.1 SB_11487| Best HMM Match : Guanylate_cyc (HMM E-Value=2.3e-06) 27 9.4 >SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 126 bits (303), Expect = 1e-29 Identities = 54/72 (75%), Positives = 61/72 (84%) Frame = +2 Query: 290 VPMKRIKFKTNLEHEYIQNFKILXAGFKKMGVDKIVPIDKLVKGRFQDNFEFLQWFKKFF 469 VP+K++KF EHEYI NFKIL + FKK G DKI+P+DKLVKGRFQDNFEFLQWFKKFF Sbjct: 43 VPLKKVKFGAKQEHEYIANFKILQSAFKKCGCDKIIPVDKLVKGRFQDNFEFLQWFKKFF 102 Query: 470 DANYGGAAYDAV 505 DANYGG Y+AV Sbjct: 103 DANYGGQEYNAV 114 >SB_50092| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=2.1e-33) Length = 386 Score = 30.7 bits (66), Expect = 0.76 Identities = 25/78 (32%), Positives = 31/78 (39%), Gaps = 5/78 (6%) Frame = +2 Query: 230 RRVVYXCRHCQFMDMLFPGSVPMKRIKFKTNLEH-----EYIQNFKILXAGFKKMGVDKI 394 RR C H +F P K K+ T L H E I NF L G D I Sbjct: 85 RRPHILCNHARFNKKPMNILFPKKDTKYLTILRHPVTHFESIFNFMKLWDSLNIKGRDSI 144 Query: 395 VPIDKLVKGRFQDNFEFL 448 +DK ++G N E+L Sbjct: 145 EIMDKFLQGNSSFNPEYL 162 >SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68) Length = 401 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 168 LSRHDMLAWVNDCLQSNFAKIEELCTXAAIASSWTCCSL 284 L D+L W++ + AK + C + +WT CSL Sbjct: 47 LENVDVLMWIHSSAAKSLAKTKLRCLRLSWKQAWTPCSL 85 >SB_58733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2060 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 413 VKGRFQDNFEFLQWFKKFFDANYGGAAYD 499 V + +DNF +QW K F D Y + +D Sbjct: 1775 VSKQMKDNFPCMQWTKNFLDNAYSTSEHD 1803 >SB_30920| Best HMM Match : DUP (HMM E-Value=4.6) Length = 404 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 493 CRTSIVGVKEFLE--PLQKLKIILETTLHQFVNG 398 C T+I GVKEFL P +K L+ L Q+ G Sbjct: 306 CPTAIPGVKEFLNSVPAKKCTARLDLALQQYEKG 339 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +2 Query: 302 RIKFKTNLEHEYIQNFKILXAGFKKMGVDKIVPIDKL 412 +I+ K N+E E ++ IL F KMG D P DKL Sbjct: 788 QIRPKHNMEPEKFESNPILFGDFMKMGAD---PADKL 821 >SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -3 Query: 355 YFKVLYIFMFQICLKFDSFHWYTAREQHVHELAM 254 Y V Y+F+F L++ H++ E+ +H+ + Sbjct: 595 YVMVCYVFVFCALLEYAVVHYFFVYEKQIHQFQL 628 >SB_2066| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 1256 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 202 IVSSQTLRRSKSCVXVPPLPVHGHAVPWQ 288 I+ S+TLR S C+ +P H V W+ Sbjct: 1053 IIMSETLRDSLDCMYDARIPTHWKKVSWE 1081 >SB_11487| Best HMM Match : Guanylate_cyc (HMM E-Value=2.3e-06) Length = 360 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 503 RRHMPHLHSWRQRIS*TIAKTQNYLGNDPSPVCQWVLSCPHPSF*NQL 360 ++ M +LHS R + N++ P+ + Q VL+C P F QL Sbjct: 170 KQGMKYLHSMEVRTYQSNVPILNHIPYIPTEIIQKVLACSDPPFRPQL 217 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,850,768 Number of Sequences: 59808 Number of extensions: 343308 Number of successful extensions: 778 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -