BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0438 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0633 + 19540584-19541383,19541557-19541610,19542123-19542444 27 8.4 06_01_0643 + 4661713-4661901,4661907-4662155,4662307-4662336 27 8.4 >08_02_0633 + 19540584-19541383,19541557-19541610,19542123-19542444 Length = 391 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = -2 Query: 261 VASXASPFSAGESSGASSVPFSLPLLSAASTFLAGDFLTGDXFGSVEVTXSGATS 97 +A+ + S ++P + PL++AAS+ D G G E + S A + Sbjct: 184 IAASKNASSRSRGGAGRAMPINAPLVAAASSSSGSDHSGGGDDGGSETSSSSAAA 238 >06_01_0643 + 4661713-4661901,4661907-4662155,4662307-4662336 Length = 155 Score = 27.1 bits (57), Expect = 8.4 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = -2 Query: 261 VASXASPFSAGESSGASSVPFS--LPLLSAASTFLAGDFLTGDXFGSVEVTXSGATSFLS 88 VA SAGE+SG +VP++ L L AS +G +T S V G T FL Sbjct: 84 VAGDTDGDSAGEASGTGTVPYAEFLRLCCDASGAESGASVTCALDESGSVIVLGKTVFLR 143 Query: 87 TAASAIVA 64 S ++ Sbjct: 144 PEMSVFLS 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,487,217 Number of Sequences: 37544 Number of extensions: 135236 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -