BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0431 (555 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 33 0.008 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 33 0.008 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 27 0.55 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 27 0.55 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 26 0.95 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 26 0.95 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 25 1.3 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 24 2.9 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 6.7 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 23 8.9 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 23 8.9 AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like p... 23 8.9 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 23 8.9 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 23 8.9 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 32.7 bits (71), Expect = 0.008 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396 Y+ ++C+ + G+C +G C F+H+ + Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSD 204 Score = 30.7 bits (66), Expect = 0.034 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286 Y+ ++C+ ++E G C +GD+ L ++Y Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 205 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 32.7 bits (71), Expect = 0.008 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = +1 Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396 Y+ ++C+ + G+C +G C F+H+ + Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSD 204 Score = 30.7 bits (66), Expect = 0.034 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286 Y+ ++C+ ++E G C +GD+ L ++Y Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 205 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 26.6 bits (56), Expect = 0.55 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240 HH GS ATSH ++Q A PT+ G + Sbjct: 24 HH---GSIATSHSTIQHHAAPTIQHVGSV 49 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 26.6 bits (56), Expect = 0.55 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240 HH GS ATSH ++Q A PT+ G + Sbjct: 24 HH---GSIATSHSTIQHHAAPTIQHVGSV 49 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.8 bits (54), Expect = 0.95 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 169 GSSATSHKSLQDRALPTV*RSGGL 240 GS ATSH S+Q A P + G + Sbjct: 26 GSIATSHSSIQHHAAPAIHHVGSI 49 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.8 bits (54), Expect = 0.95 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240 HH GS ATSH S+Q A P + G + Sbjct: 24 HH---GSIATSHSSIQHHAAPAIHHVGSV 49 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 25.4 bits (53), Expect = 1.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 513 WRCGRAWRSRPVXHIRRHRSAR 448 WRC RA SRP+ R R R Sbjct: 7 WRCARASPSRPILTTRGRRWPR 28 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 24.2 bits (50), Expect = 2.9 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 337 HSVGFCPYGPRCHFVHNAEE 396 +S+ FCPY R H + +A++ Sbjct: 25 YSMRFCPYAQRVHLMLDAKK 44 Score = 22.6 bits (46), Expect = 8.9 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -2 Query: 434 NEPPG--DDGSLRLASSALCTKWQR 366 + PP DDG LRL S C QR Sbjct: 11 SSPPSLPDDGKLRLYSMRFCPYAQR 35 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.0 bits (47), Expect = 6.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 265 AHGVRELRNLQRHPKYKTELCRT 333 +HG R L + QR YK EL T Sbjct: 233 SHGDRLLEDRQRFDNYKRELKET 255 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 22.6 bits (46), Expect = 8.9 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -2 Query: 458 DPPDESDANEPP--GDDGSLR 402 D P E DA EPP G D +LR Sbjct: 156 DSPLEDDAEEPPVEGIDPALR 176 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 22.6 bits (46), Expect = 8.9 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -2 Query: 458 DPPDESDANEPP--GDDGSLR 402 D P E DA EPP G D +LR Sbjct: 156 DSPLEDDAEEPPVEGIDPALR 176 >AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 22.6 bits (46), Expect = 8.9 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -2 Query: 458 DPPDESDANEPP--GDDGSLR 402 D P E DA EPP G D +LR Sbjct: 156 DSPLEDDAEEPPVEGIDPALR 176 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 22.6 bits (46), Expect = 8.9 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -2 Query: 458 DPPDESDANEPP--GDDGSLR 402 D P E DA EPP G D +LR Sbjct: 156 DSPLEDDAEEPPVEGIDPALR 176 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 22.6 bits (46), Expect = 8.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 365 RVAISCITQRKQDAENHRRQEVHWHRSHRAD 457 +V I + Q + H+RQ+ H R H D Sbjct: 169 QVVIGTQQECLQPEQQHQRQQQHTVRRHNVD 199 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 568,937 Number of Sequences: 2352 Number of extensions: 11601 Number of successful extensions: 69 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -