BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0425 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosac... 28 1.5 SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2... 27 3.4 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 25 7.9 >SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 27.9 bits (59), Expect = 1.5 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 375 YLDAQ-YYGVISIGTPPQSFKVVFDTGSSNLWVPSK 479 Y DA Y+ +++G+ + + + DTGS WV +K Sbjct: 70 YTDAGGYFANLTLGSNERVYSLTLDTGSPYTWVTAK 105 >SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 413 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 482 LFGRHPEVGGSGVEYHLERLRRRADTDHSVVLSIK 378 +FG + E GG G +R RR +D H +S++ Sbjct: 95 MFGMNFEAGGPGKNVPRDRKRRGSDVIHDYEISLE 129 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 25.4 bits (53), Expect = 7.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 158 ISKSPSCGF*KQQWERYLYF 217 + K P CGF W +L+F Sbjct: 644 VGKGPGCGFWAPSWRVWLFF 663 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,740,697 Number of Sequences: 5004 Number of extensions: 55900 Number of successful extensions: 144 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -