BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0425 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0039 - 10490522-10490606,10490674-10490810,10491107-104912... 89 4e-18 05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970,211... 84 9e-17 01_06_0158 - 27079262-27079346,27079662-27079750,27080540-270806... 83 2e-16 05_07_0145 + 28012268-28012624,28012734-28012794,28013758-280138... 81 1e-15 01_05_0795 + 25287449-25287967,25288078-25288138,25288640-252887... 75 4e-14 02_05_0763 + 31583449-31583747,31584095-31584230,31584544-315845... 42 4e-04 05_06_0040 + 25116732-25118030 41 0.001 07_03_0712 - 20878272-20879633 40 0.001 04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861,854... 38 0.006 07_03_0705 - 20846810-20848165 38 0.010 06_03_0732 + 23965090-23965431,23965610-23965746,23967359-239674... 38 0.010 09_06_0132 - 21042653-21042873,21042950-21043027,21043106-210431... 37 0.013 03_02_0811 + 11437654-11438958 37 0.013 03_02_0806 + 11391880-11391916,11392247-11393634 37 0.013 09_04_0549 + 18478475-18478664,18479381-18480648 37 0.018 09_04_0547 + 18467016-18467205,18467922-18469189 37 0.018 07_03_0708 - 20865786-20867153 37 0.018 04_04_1647 + 35032328-35033803 37 0.018 12_01_0345 - 2649701-2650819 36 0.031 06_03_1412 + 29993566-29993873,29993960-29994583,29994665-299948... 36 0.031 03_02_0809 + 11419318-11420493 36 0.041 01_06_0258 + 27950196-27950749,27953670-27954570 36 0.041 01_01_0555 + 4080316-4081680 36 0.041 09_04_0355 + 16922863-16924224 35 0.054 09_04_0353 + 16915618-16916934 35 0.054 04_03_0432 - 15861997-15862096,15862449-15862519,15862612-158627... 35 0.054 01_06_0905 + 32880368-32880633,32882439-32882568,32882704-328828... 35 0.054 01_06_0523 - 30009191-30010531 35 0.054 05_04_0147 - 18419864-18421297 35 0.071 02_05_0626 - 30456714-30456829,30456951-30457023,30457136-304572... 34 0.12 07_03_0704 + 20831071-20832381 33 0.16 05_04_0099 - 17991569-17993014 33 0.16 04_04_0040 + 22322839-22324173 33 0.16 04_03_0428 - 15820169-15820236,15820296-15820367,15820450-158205... 33 0.16 04_03_0418 - 15686775-15686842,15686902-15686973,15687056-156871... 33 0.16 04_01_0509 + 6668208-6668653,6669776-6669779 33 0.16 03_02_0807 + 11398845-11399999 33 0.16 02_03_0194 - 16215032-16215177,16215322-16215393,16215518-162155... 33 0.16 02_02_0636 + 12463660-12465204 33 0.16 06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253,896... 33 0.22 05_07_0313 - 29159638-29161065 33 0.22 01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 33 0.22 06_01_0746 + 5580755-5582119 33 0.29 01_06_1740 - 39575614-39576981 33 0.29 01_01_0261 + 2119519-2121033 33 0.29 07_03_0710 - 20873420-20874745 32 0.38 05_07_0071 - 27481876-27482737,27484328-27484950 32 0.38 04_04_1586 - 34621945-34623366 32 0.38 04_04_0042 + 22328464-22329858 32 0.38 02_05_0552 - 29911280-29912541,29912633-29912762 32 0.38 12_02_0913 + 24246217-24247557 32 0.50 08_02_0960 + 23058393-23059739 32 0.50 08_01_0711 - 6275052-6276401 32 0.50 03_02_0519 + 9066918-9068261 32 0.50 02_05_0551 + 29907768-29907909,29907995-29909280 32 0.50 01_06_1318 - 36261483-36262811 32 0.50 12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896,393... 31 0.67 07_03_1115 - 24076506-24076677,24077169-24077266,24077622-240777... 31 0.67 04_03_0316 + 14261942-14262506,14262710-14263134 31 0.67 01_05_0596 + 23511148-23512650 31 0.88 11_01_0539 + 4268326-4268450,4268586-4268751 31 1.2 10_08_0769 + 20452130-20453314 31 1.2 10_08_0766 + 20437772-20438956 31 1.2 01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 31 1.2 10_08_0774 + 20478203-20479393 30 1.5 09_06_0239 - 21794691-21795986 30 1.5 06_01_0772 + 5770502-5770619,5771035-5772335 30 2.0 02_05_0554 + 29929860-29929959,29932944-29934220 30 2.0 10_08_0775 + 20484776-20486035 29 3.5 10_08_0773 + 20474642-20475835 29 3.5 10_08_0772 + 20471748-20473004 29 3.5 10_08_0770 + 20459888-20461036 29 3.5 02_05_1291 - 35516715-35517251,35517339-35518185,35518480-355190... 29 3.5 03_02_0810 + 11429776-11429985,11430003-11430935 29 4.7 01_07_0213 - 42028941-42029055,42029444-42029480,42029876-420302... 29 4.7 12_02_1002 + 25176434-25176501,25176613-25176859,25178106-251781... 25 5.8 10_08_0778 + 20492822-20493920,20494605-20494648 28 6.2 02_01_0550 + 4044683-4044784,4044862-4044975,4045277-4045360,404... 28 8.2 >01_02_0039 - 10490522-10490606,10490674-10490810,10491107-10491248, 10491355-10491419,10491528-10491641,10491846-10492119, 10492215-10492327,10492405-10492499,10492602-10492662, 10492774-10493103 Length = 471 Score = 88.6 bits (210), Expect = 4e-18 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 3/92 (3%) Frame = +3 Query: 243 NGTIRVPLHRMKTARTHFHEVGTEL---ELLRLKYDVTGPSPEPLSNYLDAQYYGVISIG 413 +G +R+ L++ + + G +L E RL+ D G PL NYLD QY+G I IG Sbjct: 26 DGLLRISLNKKRLDKKTLD--GAKLAREESHRLRADGLGDDIVPLDNYLDTQYFGEIGIG 83 Query: 414 TPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 TPPQ+F V+FDTGSSNLWVPS KC Y +IAC+ Sbjct: 84 TPPQNFTVIFDTGSSNLWVPSVKC-YFSIACY 114 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 506 FLHNKYDSRKSKTYVANGHPVSRYSTGSGSL 598 +LH++Y S+ S +Y NG S S GSGS+ Sbjct: 114 YLHHRYKSKGSSSYKKNGESCS-ISYGSGSI 143 >05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970, 2116072-2116184,2116278-2116551,2116923-2117036, 2117169-2117233,2117325-2117466,2117547-2117666, 2118153-2118241,2118349-2118433 Length = 496 Score = 84.2 bits (199), Expect = 9e-17 Identities = 37/60 (61%), Positives = 46/60 (76%) Frame = +3 Query: 330 LKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 LK + P PL +YL+ QYYGVI +G+PPQ+F V+FDTGSSNLWVPS KC Y +IAC+ Sbjct: 57 LKTGSSDSDPVPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKC-YFSIACY 115 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/31 (38%), Positives = 23/31 (74%) Frame = +2 Query: 506 FLHNKYDSRKSKTYVANGHPVSRYSTGSGSL 598 +LH++Y+S+KS +Y A+G + + GSG++ Sbjct: 115 YLHSRYNSKKSSSYKADGE-TCKITYGSGAI 144 >01_06_0158 - 27079262-27079346,27079662-27079750,27080540-27080659, 27080738-27080894,27081167-27081231,27081323-27081436, 27082109-27082178,27082412-27082642,27082963-27083039, 27083143-27083237,27084514-27084574,27084678-27085073 Length = 519 Score = 83.4 bits (197), Expect = 2e-16 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 366 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 L NYL+AQYYG I+IGTPPQ F V+FDTGSSNLWVPS KCH +IAC+ Sbjct: 90 LKNYLNAQYYGEIAIGTPPQMFTVIFDTGSSNLWVPSSKCH-LSIACY 136 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 506 FLHNKYDSRKSKTYVANGHPVS-RYSTGS 589 + H++Y + +S TY NG P S Y TG+ Sbjct: 136 YFHSRYKAGQSSTYKKNGKPASIHYGTGA 164 >05_07_0145 + 28012268-28012624,28012734-28012794,28013758-28013852, 28013944-28014056,28014436-28014604,28014677-28014716, 28014797-28014861,28015485-28015598,28015687-28015751, 28015927-28016083,28016167-28016286,28016447-28016535, 28016631-28016715 Length = 509 Score = 80.6 bits (190), Expect = 1e-15 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +3 Query: 366 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 L NY++AQY+G I +GTPPQ F V+FDTGSSNLWVPS KC Y +IACF Sbjct: 77 LKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKC-YFSIACF 123 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 506 FLHNKYDSRKSKTYVANGHPVS-RYSTGS 589 F H++Y S +S TY NG P + +Y TGS Sbjct: 123 FFHSRYKSGQSSTYQKNGKPAAIQYGTGS 151 >01_05_0795 + 25287449-25287967,25288078-25288138,25288640-25288734, 25288827-25288939,25289480-25289648,25289777-25289816, 25289906-25289970,25290150-25290263,25290398-25290462, 25290572-25290725,25290798-25290914,25292489-25292545 Length = 522 Score = 75.4 bits (177), Expect = 4e-14 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +3 Query: 357 PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 P L N+L+AQY+G I +G PPQ+F VVFDTGSSNLWVPS KC + ++AC+ Sbjct: 128 PLALKNFLNAQYFGEIGVGCPPQNFTVVFDTGSSNLWVPSAKCVF-SLACY 177 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 506 FLHNKYDSRKSKTYVANGHPVS-RYSTGS 589 + H KY+SR S TY+ NG P S Y TGS Sbjct: 177 YFHRKYESRSSSTYMENGTPASIHYGTGS 205 >02_05_0763 + 31583449-31583747,31584095-31584230,31584544-31584593, 31585586-31585852,31586481-31586708,31586873-31587011, 31587091-31587161,31587313-31587412,31588201-31588264, 31588346-31588417,31588500-31588720 Length = 548 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/57 (43%), Positives = 29/57 (50%) Frame = +3 Query: 303 VGTELELLRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 473 VG + +LL L G S P N L YY + +GTP SF V DTGS WVP Sbjct: 76 VGGKYQLLSLSQ---GGSIFPSGNDLGWLYYTWVDVGTPNTSFLVALDTGSDLFWVP 129 >05_06_0040 + 25116732-25118030 Length = 432 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +3 Query: 360 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 473 EP++ Y D Y +++G PPQ F+V DTGS WVP Sbjct: 16 EPVTTYTDG-YLLSLNLGMPPQVFQVYLDTGSDLTWVP 52 >07_03_0712 - 20878272-20879633 Length = 453 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +3 Query: 342 VTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 V+ P+ + L N +Y ++IGTPPQS+ + DTGS +W C Sbjct: 78 VSAPTRKDLPN--GGEYIMTLAIGTPPQSYPAIADTGSDLVWTQCAPC 123 >04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861, 8540190-8540413,8540491-8540715,8541520-8541619, 8541703-8541763,8543029-8543100,8543183-8543406 Length = 477 Score = 38.3 bits (85), Expect = 0.006 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVP 473 +Y ++++GTP Q+F V DTGS W+P Sbjct: 116 HYALVTVGTPGQTFMVALDTGSDLFWLP 143 >07_03_0705 - 20846810-20848165 Length = 451 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +3 Query: 402 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +SIGTPP +F V+ DTGSS +W C Sbjct: 94 LSIGTPPVTFSVLADTGSSLIWTQCAPC 121 >06_03_0732 + 23965090-23965431,23965610-23965746,23967359-23967417, 23968817-23970135 Length = 618 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 Y + +GTP + VVFDTGS WV + C +AC+ Sbjct: 282 YVVTVGLGTPASRYTVVFDTGSDTTWVQCQPC---VVACY 318 >09_06_0132 - 21042653-21042873,21042950-21043027,21043106-21043167, 21043504-21043578,21043664-21043752,21043825-21043905, 21044939-21045076,21046299-21046429,21046521-21046592, 21047218-21047275,21047362-21047461,21047544-21047617, 21047701-21047836,21047913-21048137,21048211-21048446, 21048949-21049081,21049195-21049484 Length = 732 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVP 473 +Y V+++GTP +F V DTGS WVP Sbjct: 99 HYAVVALGTPNVTFLVALDTGSDLFWVP 126 >03_02_0811 + 11437654-11438958 Length = 434 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +3 Query: 327 RLKYDVTGP-SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 RL + P SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 59 RLSSSASAPVSPGTYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 113 >03_02_0806 + 11391880-11391916,11392247-11393634 Length = 474 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 381 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 D +Y ++IGTPPQ +++ DTGS W C ++CF Sbjct: 108 DTEYLVHMAIGTPPQPVQLILDTGSDLTWTQCAPC----VSCF 146 >09_04_0549 + 18478475-18478664,18479381-18480648 Length = 485 Score = 36.7 bits (81), Expect = 0.018 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >09_04_0547 + 18467016-18467205,18467922-18469189 Length = 485 Score = 36.7 bits (81), Expect = 0.018 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >07_03_0708 - 20865786-20867153 Length = 455 Score = 36.7 bits (81), Expect = 0.018 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 402 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 IS+GTPP F V+ DTGS+ +W C Sbjct: 95 ISLGTPPLDFPVIVDTGSNLIWAQCAPC 122 >04_04_1647 + 35032328-35033803 Length = 491 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +3 Query: 345 TGPSPEPLSNYLDAQYYG---VISIGTPPQSFKVVFDTGSSNLWVP 473 T P P ++ Y G +S+GTPPQ V+ +TGS WVP Sbjct: 71 TAPPPSVRASLYPHSYGGYAFTVSLGTPPQPLPVLLETGSHLSWVP 116 >12_01_0345 - 2649701-2650819 Length = 372 Score = 35.9 bits (79), Expect = 0.031 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y+ IS+GTPP V DTGS+ WV K C Sbjct: 24 KYFMGISLGTPPVFNLVTIDTGSTLSWVQCKNC 56 >06_03_1412 + 29993566-29993873,29993960-29994583,29994665-29994800, 29995108-29995196,29995299-29995413,29995565-29995628, 29995711-29995782,29995906-29996153 Length = 551 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVP--SKKC 485 +Y +++GTP +F V DTGS WVP K+C Sbjct: 105 HYAEVAVGTPNTTFLVALDTGSDLFWVPCDCKQC 138 >03_02_0809 + 11419318-11420493 Length = 391 Score = 35.5 bits (78), Expect = 0.041 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 354 SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 22 SPGAYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 66 >01_06_0258 + 27950196-27950749,27953670-27954570 Length = 484 Score = 35.5 bits (78), Expect = 0.041 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 488 QY+ +GTP Q F +V DTGS WV KCH Sbjct: 86 QYFVRFRVGTPAQPFLLVADTGSDLTWV---KCH 116 >01_01_0555 + 4080316-4081680 Length = 454 Score = 35.5 bits (78), Expect = 0.041 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKK 482 +Y +++G+PP+S + DTGS +WV KK Sbjct: 100 EYLMTVNLGSPPRSMLAIADTGSDLVWVKCKK 131 >09_04_0355 + 16922863-16924224 Length = 453 Score = 35.1 bits (77), Expect = 0.054 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 381 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 D +Y +++GTPPQ + DTGS +W C Sbjct: 95 DLEYVLDLAVGTPPQPITALLDTGSDLIWTQCDTC 129 >09_04_0353 + 16915618-16916934 Length = 438 Score = 35.1 bits (77), Expect = 0.054 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 366 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 L + + +Y + IG+PP+ F + DTGS +W C Sbjct: 77 LLRFSEGEYLMDVGIGSPPRYFSAMIDTGSDLIWTQCAPC 116 >04_03_0432 - 15861997-15862096,15862449-15862519,15862612-15862774, 15865311-15865535,15866156-15866403,15866489-15866618, 15866716-15866975 Length = 398 Score = 35.1 bits (77), Expect = 0.054 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 YY I IGTP + + V DTGS LWV C Sbjct: 89 YYTEIGIGTPTKRYYVQVDTGSDILWVNCISC 120 >01_06_0905 + 32880368-32880633,32882439-32882568,32882704-32882894, 32883625-32883852,32884062-32884224,32884343-32884416, 32884484-32884601,32884722-32884788,32885152-32885223, 32885350-32885513 Length = 490 Score = 35.1 bits (77), Expect = 0.054 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y+ + +G+PP+ + V DTGS LWV C Sbjct: 91 YFTRVKLGSPPKEYFVQIDTGSDILWVACSPC 122 >01_06_0523 - 30009191-30010531 Length = 446 Score = 35.1 bits (77), Expect = 0.054 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +3 Query: 339 DVTGPSPEPLSN---YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 D TG P+ + + +Y+ ++ +GTP +V DTGS +W+ C Sbjct: 66 DATGRLHSPVFSGIPFESGEYFALVGVGTPSTKAMLVIDTGSDLVWLQCSPC 117 >05_04_0147 - 18419864-18421297 Length = 477 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 351 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 PS P + Y + +GTPPQ FD S +WVP ++C Sbjct: 76 PSQAPATT--GGTYLITVGVGTPPQYVYGAFDISSQFVWVPCEEC 118 >02_05_0626 - 30456714-30456829,30456951-30457023,30457136-30457250, 30457368-30457450,30457532-30457685,30457859-30458095, 30458212-30458435,30458657-30458774,30459286-30459614 Length = 482 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 381 DAQYYGVISIGTPPQSFKVVFDTGSSNLWV 470 D QYY I +G PP+ + + DTGS W+ Sbjct: 109 DGQYYTSIFVGNPPRPYFLDVDTGSDLTWI 138 >07_03_0704 + 20831071-20832381 Length = 436 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 402 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 IS+GTP +F VV DTGS +W C Sbjct: 90 ISVGTPLLTFSVVADTGSDLIWTQCAPC 117 >05_04_0099 - 17991569-17993014 Length = 481 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 QY IG PPQ + V DTGS +W C Sbjct: 77 QYIASYGIGDPPQPAEAVVDTGSDLVWTQCSTC 109 >04_04_0040 + 22322839-22324173 Length = 444 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 402 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +SIGTP ++ + DTGS +W K C Sbjct: 99 VSIGTPALAYSAIVDTGSDLVWTQCKPC 126 >04_03_0428 - 15820169-15820236,15820296-15820367,15820450-15820519, 15824222-15824312,15825023-15825093,15825176-15825341, 15826169-15826393,15829075-15829307,15829464-15829618, 15829636-15829855 Length = 456 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >04_03_0418 - 15686775-15686842,15686902-15686973,15687056-15687125, 15690828-15690918,15691629-15691699,15691782-15691947, 15692775-15692999,15695681-15695913,15696070-15696224, 15696242-15696461 Length = 456 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >04_01_0509 + 6668208-6668653,6669776-6669779 Length = 149 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 +Y+ IG PPQ + + DTGS+ +W C CF Sbjct: 80 EYFTEYLIGDPPQHAEAIVDTGSNLVWTQCTDCLAVADRCF 120 >03_02_0807 + 11398845-11399999 Length = 384 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y ++IGTPPQ ++ DTGS +W + C Sbjct: 34 EYLLHLAIGTPPQPVQLTLDTGSVLVWTQCQPC 66 >02_03_0194 - 16215032-16215177,16215322-16215393,16215518-16215593, 16215984-16216074,16216188-16216258,16216344-16216506, 16218841-16219065,16219206-16219507,16219551-16219680, 16219783-16220045 Length = 512 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y+ I IGTP + + V DTGS LWV C Sbjct: 90 YFTRIGIGTPAKRYYVQVDTGSDILWVNCVSC 121 >02_02_0636 + 12463660-12465204 Length = 514 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y + +GTPP+ F+++ DTGS W+ C Sbjct: 151 EYLVDLYVGTPPRRFQMIMDTGSDLNWLQCAPC 183 >06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253, 8968352-8968588,8969122-8969275,8969356-8969438, 8969573-8969687,8969837-8969909,8970005-8970147 Length = 538 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 381 DAQYYGVISIGTPPQSFKVVFDTGSSNLWV 470 D QYY + IG PP+ + + DTGS W+ Sbjct: 156 DGQYYTSMYIGNPPRPYFLDVDTGSDLTWI 185 >05_07_0313 - 29159638-29161065 Length = 475 Score = 33.1 bits (72), Expect = 0.22 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY 491 +Y+ + +GTP + +V DTGS +W+ C + Sbjct: 121 EYFAQVGVGTPATTALMVLDTGSDVVWLQCAPCRH 155 >01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 Length = 492 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 357 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 P L + LD Y + + +G+P + +VV DTGS WV + C Sbjct: 136 PTTLGSSLDTLEYVISVGLGSPAVTQRVVIDTGSDVSWVQCEPC 179 >06_01_0746 + 5580755-5582119 Length = 454 Score = 32.7 bits (71), Expect = 0.29 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y +S+GTPP+ + DTGS +W C Sbjct: 89 EYLMHVSVGTPPRPVALTLDTGSDLVWTQCAPC 121 >01_06_1740 - 39575614-39576981 Length = 455 Score = 32.7 bits (71), Expect = 0.29 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -2 Query: 697 GKPGLPTRPSANVWRPHLEPXXXXXHQWRGSPEXAAGARTVSRN 566 G P LP R S + WRPH EP SP A ART +++ Sbjct: 212 GTPALPGRSSPSPWRPHNEPGSYASP----SPSSEAPARTPAKS 251 >01_01_0261 + 2119519-2121033 Length = 504 Score = 32.7 bits (71), Expect = 0.29 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y+ + +G+P + +V DTGS WV + C Sbjct: 166 EYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPC 198 >07_03_0710 - 20873420-20874745 Length = 441 Score = 32.3 bits (70), Expect = 0.38 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +3 Query: 384 AQYYGVISIGTPPQSFKVVFDTGSSNLW----VPSKKC 485 A Y I+IGTPP V DTGS +W P ++C Sbjct: 90 ATYLVDIAIGTPPLPLTAVLDTGSDLIWTQCDAPCRRC 127 >05_07_0071 - 27481876-27482737,27484328-27484950 Length = 494 Score = 32.3 bits (70), Expect = 0.38 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWV 470 QY+ +GTP Q F ++ DTGS WV Sbjct: 109 QYFVRFRVGTPAQPFVLIADTGSDLTWV 136 >04_04_1586 - 34621945-34623366 Length = 473 Score = 32.3 bits (70), Expect = 0.38 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y+ + +G+PP +V D+GS +WV + C Sbjct: 129 EYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPC 161 >04_04_0042 + 22328464-22329858 Length = 464 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y + IGTPP F DT S +W + C Sbjct: 88 EYLVKLGIGTPPYKFTAAIDTASDLIWTQCQPC 120 >02_05_0552 - 29911280-29912541,29912633-29912762 Length = 463 Score = 32.3 bits (70), Expect = 0.38 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 342 VTGPSPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 V+ P L + LD Y + + +GTP + V DTGS WV C Sbjct: 110 VSSSVPTKLGSSLDTLEYVISVGLGTPAVTQTVTIDTGSDVSWVQCNPC 158 >12_02_0913 + 24246217-24247557 Length = 446 Score = 31.9 bits (69), Expect = 0.50 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 QY IG PPQ + + DTGS +W C Sbjct: 89 QYVAEYLIGDPPQRAEALIDTGSDLVWTQCSTC 121 >08_02_0960 + 23058393-23059739 Length = 448 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y ++IGTPP + + DTGS +W C Sbjct: 91 EYLMDLAIGTPPLRYTAMVDTGSDLIWTQCAPC 123 >08_01_0711 - 6275052-6276401 Length = 449 Score = 31.9 bits (69), Expect = 0.50 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +3 Query: 363 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNI 500 P Y D Y + IG Q ++ DTGSS +W +C + +I Sbjct: 73 PFRIYEDVVYLAEMEIGERQQKQYLLIDTGSSLVWTQCDECPHCHI 118 >03_02_0519 + 9066918-9068261 Length = 447 Score = 31.9 bits (69), Expect = 0.50 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 402 ISIGTPPQSFKVVFDTGSSNLWV 470 +++GTPPQ+ +V DTGS W+ Sbjct: 59 VAVGTPPQNVTMVLDTGSELSWL 81 >02_05_0551 + 29907768-29907909,29907995-29909280 Length = 475 Score = 31.9 bits (69), Expect = 0.50 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 QY +S+GTP + + DTGS WV K C Sbjct: 141 QYVVTVSLGTPAVAQTLEVDTGSDVSWVQCKPC 173 >01_06_1318 - 36261483-36262811 Length = 442 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +3 Query: 324 LRLKYDVTGPSPEPLSN---YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWV 470 LR + G P P S + + +++GTPPQ+ +V DTGS W+ Sbjct: 41 LRARQVPAGALPRPASKLRFHHNVSLTVSLAVGTPPQNVTMVLDTGSELSWL 92 >12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896, 3932992-3933225,3933659-3933797,3933878-3934096, 3934148-3934220,3934319-3934428 Length = 431 Score = 31.5 bits (68), Expect = 0.67 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 375 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC 506 Y YY +SIG PP+ + + DTGS W+ +C ++C Sbjct: 53 YPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWL---QCDAPCVSC 93 >07_03_1115 - 24076506-24076677,24077169-24077266,24077622-24077743, 24079059-24079235,24079809-24079897,24079919-24079965, 24080423-24080519,24080600-24080682,24080716-24080796, 24081043-24081199,24081323-24081750,24081985-24082014, 24083180-24083300,24083432-24083697 Length = 655 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 390 YYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 YY + IGTP Q F ++ D+GS+ +VP C Sbjct: 90 YYTTRLYIGTPSQEFALIVDSGSTVTYVPCATC 122 >04_03_0316 + 14261942-14262506,14262710-14263134 Length = 329 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 +Y ++ GTP Q ++ DTGS W K+C Sbjct: 43 EYLVHLAAGTPRQEVQLTLDTGSDIAWTQCKRC 75 >01_05_0596 + 23511148-23512650 Length = 500 Score = 31.1 bits (67), Expect = 0.88 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +3 Query: 387 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCH 488 +Y+ I +GTP +V DTGS +W+ P ++C+ Sbjct: 146 EYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCY 182 >11_01_0539 + 4268326-4268450,4268586-4268751 Length = 96 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +3 Query: 375 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWV----PSKKCHYTNIA 503 Y +++ ++IG P + + + DTGS WV P + CH +A Sbjct: 39 YPSGRFFVTMNIGVPEKPYFLDIDTGSDLTWVECDAPCQSCHQACVA 85 >10_08_0769 + 20452130-20453314 Length = 394 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >10_08_0766 + 20437772-20438956 Length = 394 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 Length = 508 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 348 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 G S +P +N Y S+GTPPQ V D S +W+ C Sbjct: 85 GQSQDPATN--TGMYVLSFSVGTPPQVVTGVLDITSDFVWMQCSAC 128 >10_08_0774 + 20478203-20479393 Length = 396 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = +3 Query: 288 THFHEVGTELELLRLKYDVTGPSPEPLS---NYLDAQYYGVISIGTPPQSFKVVFDTGSS 458 T HE+ LEL D T P ++ ++ A Y ++IGTPPQ + D G Sbjct: 17 TRAHELRRGLELAD---DATTARPGGVTVPVHFSQAFYVVNLTIGTPPQPVSAIIDIGGE 73 Query: 459 NLW 467 +W Sbjct: 74 LVW 76 >09_06_0239 - 21794691-21795986 Length = 431 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 402 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 + IGTP + +VFDT S LW + C Sbjct: 92 LGIGTPAMNVTLVFDTTSDLLWTQCQPC 119 >06_01_0772 + 5770502-5770619,5771035-5772335 Length = 472 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 369 SNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 S+ D + +S+G PP V DTGS+ WV + C Sbjct: 107 SSINDFLFLMAVSLGKPPVVNLVAIDTGSTLSWVQCQPC 145 >02_05_0554 + 29929860-29929959,29932944-29934220 Length = 458 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y + +GTP + +V DTGSS W+ C Sbjct: 122 YVTRMGLGTPATQYVMVVDTGSSLTWLQCSPC 153 >10_08_0775 + 20484776-20486035 Length = 419 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +3 Query: 348 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 G + PL ++ A Y +IGTPPQ+ + D +W C + CF Sbjct: 49 GGAVVPL-HWSGAHYVANFTIGTPPQAVSGIVDLSGELVWTQCAACR--SSGCF 99 >10_08_0773 + 20474642-20475835 Length = 397 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +3 Query: 327 RLKYDVTGPSPEPLSNYLDAQYYGV--ISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 RL D T + + Y V +IGTPPQ + D +W +C Sbjct: 20 RLLADATPAGGSAVPIHWSRHLYNVANFTIGTPPQPASAIIDVAGELVWTQCSRC 74 >10_08_0772 + 20471748-20473004 Length = 418 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/75 (26%), Positives = 28/75 (37%), Gaps = 5/75 (6%) Frame = +3 Query: 276 KTARTHFHEVGTELELL---RLKYDVTGPSPEPLSNYLDAQYYGV--ISIGTPPQSFKVV 440 +TA H++ LE RL D T + + Y V +IGTPPQ + Sbjct: 24 RTAAFRAHDLRRGLEQAMRGRLLADATPAGGSAVPIHWSRHLYNVANFTIGTPPQPASAI 83 Query: 441 FDTGSSNLWVPSKKC 485 D +W C Sbjct: 84 IDVAGELVWTQCSMC 98 >10_08_0770 + 20459888-20461036 Length = 382 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 387 QYYGVIS--IGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACF 509 + Y V S IGTPPQ D G +W +C ++ +CF Sbjct: 21 ELYNVASFTIGTPPQPASAFIDVGGLLVWTQCSQC--SSSSCF 61 >02_05_1291 - 35516715-35517251,35517339-35518185,35518480-35519009, 35519092-35519529 Length = 783 Score = 29.1 bits (62), Expect = 3.5 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 8/100 (8%) Frame = +3 Query: 57 ICFYY-LLRCFSIXKTLRSQCSI----LINQ*ITIVNFS*ASRLVAASKNNNGKDIFIFF 221 ICFY C +I KT+ + L + +I+ A +NGK + FF Sbjct: 404 ICFYLKYYDCLTIGKTVARAMATHSHNLDSAEFSILTGKRAQHCSIDDLRHNGKQLMTFF 463 Query: 222 GADRQLRNGTIRVPLHRMKTARTH-FHEVGT--ELELLRL 332 GA G R+ L ++ A T + + T LE LRL Sbjct: 464 GACTDAFAGLTRLHLRNLRLAETDILNIIATCKRLEYLRL 503 >03_02_0810 + 11429776-11429985,11430003-11430935 Length = 380 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 384 AQYYGVISIGTPPQSFKVVFDTGS 455 ++Y ++IGTPPQ ++ DTGS Sbjct: 34 SEYLVHLTIGTPPQPVQLTLDTGS 57 >01_07_0213 - 42028941-42029055,42029444-42029480,42029876-42030244, 42030332-42031201,42051574-42052891 Length = 902 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 390 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 Y +GTP Q+ V D + WVP C Sbjct: 102 YIARAGLGTPAQTLLVAIDPSNDAAWVPCSAC 133 >12_02_1002 + 25176434-25176501,25176613-25176859,25178106-25178171, 25178754-25178822,25179007-25179080,25180850-25180991, 25181546-25181596,25181769-25181774 Length = 240 Score = 25.0 bits (52), Expect(2) = 5.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 586 LRQPXPGFLSTDDVTVGGAQGAGARRSPKAVSE 684 L P P L+ DD + G G G + AV+E Sbjct: 51 LSPPPPPELAVDDQLLAGGDGGGGKPVAVAVAE 83 Score = 21.8 bits (44), Expect(2) = 5.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 460 TSGCLPKSATTPTSL 504 TSGCLP S P L Sbjct: 45 TSGCLPLSPPPPPEL 59 >10_08_0778 + 20492822-20493920,20494605-20494648 Length = 380 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 375 YLDAQ--YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 485 YL +Q Y +IGTPPQ V D +W C Sbjct: 50 YLSSQGLYVANFTIGTPPQPVSAVVDLTGELVWTQCTPC 88 >02_01_0550 + 4044683-4044784,4044862-4044975,4045277-4045360, 4045818-4045917,4046923-4046971,4047071-4047158, 4047251-4047361,4047771-4047833,4047942-4048052, 4048517-4048582,4048689-4048766,4049553-4049630, 4049784-4049850,4049930-4050015,4050301-4050333, 4050426-4050458,4050754-4050854,4050986-4051071, 4051478-4051584,4051683-4051839,4051854-4051984 Length = 614 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 556 WAPSFAIQYGLRQPXPGFLSTDDVTVGGAQGAGARR 663 W S A++YGL G +ST+ GG + +G R Sbjct: 498 WRVSEALEYGLVGVNEGIISTEVAPFGGVKQSGLGR 533 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,977,117 Number of Sequences: 37544 Number of extensions: 423733 Number of successful extensions: 1223 Number of sequences better than 10.0: 78 Number of HSP's better than 10.0 without gapping: 1176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1223 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -