BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0423 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 46 3e-07 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 24 1.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 24 1.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 24 1.1 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 23 1.9 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 23 1.9 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 46.0 bits (104), Expect = 3e-07 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 2/82 (2%) Frame = +3 Query: 3 MIDISKNIVEYLKG--HQLEDVDVDDLMRRYTXDVIASAGFGLQVNSLVDKDNEFYECGQ 176 +I+ S N+ YL + E ++ +L R+T DVI S FG+ ++S+ ++++EF G+ Sbjct: 151 IIECSLNLETYLDKLIEKNEPIECRELTARFTTDVIGSCAFGIDMSSMTNENSEFRRMGR 210 Query: 177 AMFSTSWPQRFKMILAAQFPTL 242 +F+ ++ +M L P L Sbjct: 211 EVFAVNFMNVMRMKLKQFMPRL 232 Score = 41.1 bits (92), Expect = 9e-06 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +2 Query: 287 FFREIVTSTMDYRLKNNVERPDMIQLLMDAYKGTLKNES 403 FF +VT T+ YR NN+ RPD I +LM+ K K E+ Sbjct: 248 FFTRVVTDTIKYRNDNNIVRPDFINMLMELQKNPQKLEN 286 Score = 39.9 bits (89), Expect = 2e-05 Identities = 16/33 (48%), Positives = 26/33 (78%) Frame = +1 Query: 505 SFIFFLAGFESSANGLTLCIHELALNPEAQGKI 603 +F+FFLAGFE+S+ ++ ++ELALN + Q K+ Sbjct: 298 AFVFFLAGFETSSTTMSNALYELALNQDVQKKL 330 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 505 SFIFFLAGFESSANGLTLCIHEL 573 SF+F +A +SS T+C+ E+ Sbjct: 19 SFLFVIAAQDSSGRIFTICVPEI 41 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 505 SFIFFLAGFESSANGLTLCIHEL 573 SF+F +A +SS T+C+ E+ Sbjct: 19 SFLFVIAAQDSSGRIFTICVPEI 41 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 505 SFIFFLAGFESSANGLTLCIHEL 573 SF+F +A +SS T+C+ E+ Sbjct: 19 SFLFVIAAQDSSGRIFTICVPEI 41 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 350 DMIQLLMDAYKGTLKNESNESDEKNVGFAMTE 445 D IQL+ ++N E+DE N+G T+ Sbjct: 103 DDIQLVKGIANECIENAKGETDECNIGNKYTD 134 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 350 DMIQLLMDAYKGTLKNESNESDEKNVGFAMTE 445 D IQL+ ++N E+DE N+G T+ Sbjct: 103 DDIQLVKGIANECIENAKGETDECNIGNKYTD 134 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,920 Number of Sequences: 438 Number of extensions: 3079 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -