BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0418 (309 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2DQC7 Cluster: Putative uncharacterized protein; n=1; ... 37 0.076 UniRef50_Q22XX2 Cluster: Putative uncharacterized protein; n=1; ... 32 2.2 UniRef50_Q7RE88 Cluster: Homeobox-containing protein; n=2; Plasm... 31 5.0 UniRef50_A6LJV2 Cluster: Putative uncharacterized protein; n=1; ... 30 8.8 >UniRef50_A2DQC7 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 600 Score = 37.1 bits (82), Expect = 0.076 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 109 KINAYFLRILQVFNNNNYTCYPIDFNIAYFY 201 KIN + R++Q FNN YT Y +D++ FY Sbjct: 549 KINTFVGRVIQTFNNEIYTIYEVDYDKGLFY 579 >UniRef50_Q22XX2 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 575 Score = 32.3 bits (70), Expect = 2.2 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +1 Query: 37 IYXLFITENSFFDEKIVC*IKQTTKINAYFLRILQVFNNNNYTCYPIDFNI 189 I L +++F + + I+QT K N + + L N CYPIDF++ Sbjct: 262 IIDLIANKSNFCSNEFISEIEQTLKENKFIFQNLSFDNIYLQGCYPIDFSL 312 >UniRef50_Q7RE88 Cluster: Homeobox-containing protein; n=2; Plasmodium (Vinckeia)|Rep: Homeobox-containing protein - Plasmodium yoelii yoelii Length = 774 Score = 31.1 bits (67), Expect = 5.0 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 204 PNINRLISIAMVYDYFDNIVSCVKCM 281 PNI + + A ++ Y +N++SC+KCM Sbjct: 354 PNILKSLYDAKIFKYPNNLISCLKCM 379 >UniRef50_A6LJV2 Cluster: Putative uncharacterized protein; n=1; Thermosipho melanesiensis BI429|Rep: Putative uncharacterized protein - Thermosipho melanesiensis BI429 Length = 209 Score = 30.3 bits (65), Expect = 8.8 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = +1 Query: 37 IYXLFITENSFFDEKIVC*IKQTTKINAYFLRILQVFNNNN 159 I FI NSFF K + I + NAYFL I F NN Sbjct: 104 IVTTFIPPNSFFFPKKLSVILISAVFNAYFLGIYSFFLKNN 144 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 249,609,538 Number of Sequences: 1657284 Number of extensions: 4081391 Number of successful extensions: 8308 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8304 length of database: 575,637,011 effective HSP length: 79 effective length of database: 444,711,575 effective search space used: 10228366225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -