BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0418 (309 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|c... 23 7.9 SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosa... 23 7.9 >SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|chr 3|||Manual Length = 479 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 126 KICVYFCSLFYLAHNL 79 KI +Y SLF LA+NL Sbjct: 307 KIFIYIASLFGLAYNL 322 >SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 23.4 bits (48), Expect = 7.9 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 46 LFITENSFFDEKIVC*IKQTTKINAYFLRILQVFNNNNYT-CYPIDFNIAYFY 201 LF++ FF ++ I+Q + + ++FN NN P++ AY + Sbjct: 372 LFLSLPRFFPSELCVSIEQCIQFLSLIREQKEIFNKNNKEFINPLNIRFAYSF 424 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,138,769 Number of Sequences: 5004 Number of extensions: 19779 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 79841814 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -