BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0417 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10320.1 68416.m01238 expressed protein contains Pfam domain,... 31 0.38 At5g64300.1 68418.m08077 riboflavin biosynthesis protein, putati... 29 2.0 At2g22450.1 68415.m02662 riboflavin biosynthesis protein, putati... 29 2.0 At5g61060.1 68418.m07662 histone deacetylase family protein simi... 29 2.7 At3g42630.1 68416.m04430 pentatricopeptide (PPR) repeat-containi... 29 2.7 At3g55150.1 68416.m06125 exocyst subunit EXO70 family protein co... 27 6.2 >At3g10320.1 68416.m01238 expressed protein contains Pfam domain, PF04577: Protein of unknown function (DUF563) Length = 494 Score = 31.5 bits (68), Expect = 0.38 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +3 Query: 216 KQVDIDSNGIRLLDKYSFLCEMYDEDADEIKD---LTLNYFPFDNSVQIIDAK 365 K++ +D NG ++L + S L E YD+D +KD +T + F + + D K Sbjct: 421 KKLGLDYNGYKILPRESSLYEKYDKDDPILKDPNSITKKGWQFTKGIYLNDQK 473 >At5g64300.1 68418.m08077 riboflavin biosynthesis protein, putative (RIBA) similar to SP|P47924 {Arabidopsis thaliana}, SP|P51695 Riboflavin biosynthesis protein ribA [Includes: GTP cyclohydrolase II (EC 3.5.4.25); 3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP synthase)] {Bacillus amyloliquefaciens}; contains Pfam profiles PF00925: GTP cyclohydrolase II, PF00926: 3,4-dihydroxy-2-butanone 4-phosphate synthase Length = 384 Score = 29.1 bits (62), Expect = 2.0 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = +3 Query: 213 HKQVDIDSNGIRLLDKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQII 356 H + +D + LD LCE+ D+D + L F +N+++++ Sbjct: 111 HTEASVDLTVLAGLDPVGVLCEIVDDDGSMARLPKLREFAAENNLKVV 158 >At2g22450.1 68415.m02662 riboflavin biosynthesis protein, putative similar to SP|P50855 Riboflavin biosynthesis protein ribA [Includes: GTP cyclohydrolase II (EC 3.5.4.25); 3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP synthase)] {Actinobacillus pleuropneumoniae}; contains Pfam profiles PF00925: GTP cyclohydrolase II, PF00926: 3,4-dihydroxy-2-butanone 4-phosphate synthase Length = 476 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +3 Query: 213 HKQVDIDSNGIRLLDKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQII 356 H + +D + L+ S LCE+ D+D + L F +N++++I Sbjct: 248 HTEASVDLTVLAGLEPVSVLCEIVDDDGSMARLPRLRQFAQENNLKLI 295 >At5g61060.1 68418.m07662 histone deacetylase family protein similar to SP|Q9UBN7 Histone deacetylase 6 (HD6) {Homo sapiens}; contains Pfam profile PF00850: Histone deacetylase family Length = 660 Score = 28.7 bits (61), Expect = 2.7 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +1 Query: 37 HIYIIHNREFVSLMRRLCANKTDYKNKRI 123 H+ ++H ++ V+L++ + + DY+ RI Sbjct: 81 HLQLVHTKDHVNLVKSISTKQKDYRRNRI 109 >At3g42630.1 68416.m04430 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 415 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 333 FDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSNY-YISRLRSCYTENAF 500 F +QI+D L + +LP + ++ VN+ NY + L C+ EN F Sbjct: 41 FSQKIQIVDYAPLVQTLSQRRLPDVAHEIFLQTKSVNLLPNYRTLCALMLCFAENGF 97 >At3g55150.1 68416.m06125 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; tomato leucine zipper-containing protein, Lycopersicon esculentum, PIR:S21495 Length = 636 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 270 LCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRV 392 LC++ D A+ KD++L+Y N++QII G L+ + Sbjct: 445 LCKL-DTKAEHYKDVSLSYLFLANNLQIIIETVGSTPLRNL 484 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,531,074 Number of Sequences: 28952 Number of extensions: 159563 Number of successful extensions: 400 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -