BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0410 (338 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 3.4 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 4.6 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.0 bits (42), Expect = 3.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +3 Query: 39 IYSSHK*NKMRXIVHIQAGQCGNQIGAKFWEI 134 I + + N+++ V I C N A+F+E+ Sbjct: 283 IEAKRRDNEIKMFVKIVDASCRNFTAARFFEL 314 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 20.6 bits (41), Expect = 4.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 6/31 (19%) Frame = -1 Query: 311 CPKGXDGQS-----PXCRA-PSRRGGAGHVL 237 CPKG GQ+ C+ P + GG H L Sbjct: 210 CPKGFQGQNCELNVDDCKPNPCQNGGTCHDL 240 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,147 Number of Sequences: 336 Number of extensions: 998 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6558670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -