BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0402 (439 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) 157 4e-39 SB_54522| Best HMM Match : No HMM Matches (HMM E-Value=.) 125 1e-29 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40082| Best HMM Match : tRNA-synt_2 (HMM E-Value=8.1e-37) 33 0.078 SB_10782| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_25278| Best HMM Match : wnt (HMM E-Value=8.9e-18) 27 8.9 >SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1449 Score = 157 bits (381), Expect = 4e-39 Identities = 67/76 (88%), Positives = 74/76 (97%) Frame = +1 Query: 31 EVETPLMNXVPGGATAKPFITHHNELNMDLYMRIAPELYHKMLVVGGLDRVYEIGRQFRN 210 +VETPLMN +PGGATAKPFITHHN+LNMDL+MR+APELYHKMLVVGG+DRVYEIGRQFRN Sbjct: 758 KVETPLMNMIPGGATAKPFITHHNDLNMDLFMRVAPELYHKMLVVGGIDRVYEIGRQFRN 817 Query: 211 EGIDLTHNPEFTTCDF 258 E IDLTHNPEFTTC+F Sbjct: 818 ESIDLTHNPEFTTCEF 833 Score = 66.5 bits (155), Expect = 9e-12 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 255 FYMAYADYNDLMTITESILSGMVQSIHGSYKVKYHPE 365 FYMAYADYNDLM ITE+++SGMV++I G YKV YHPE Sbjct: 833 FYMAYADYNDLMEITETMISGMVKNITGGYKVTYHPE 869 >SB_54522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 125 bits (302), Expect = 1e-29 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = +1 Query: 34 VETPLMNXVPGGATAKPFITHHNELNMDLYMRIAPELYHKMLVVGGLDRVYEIGRQFRNE 213 VETPLMN +PGGATAKPFITHHN+LNMDL+MR+APELYHKMLVVGG+DRVYEIGRQFRNE Sbjct: 1 VETPLMNMIPGGATAKPFITHHNDLNMDLFMRVAPELYHKMLVVGGIDRVYEIGRQFRNE 60 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 258 YMAYADYNDLMTITESILSGMVQSIHGS-YKVKYHPEG 368 YMAYADY+DL+ +TES+ + Q + G+ Y+ + G Sbjct: 100 YMAYADYHDLIELTESLFRTLAQEVLGTGYRARIRNHG 137 >SB_40082| Best HMM Match : tRNA-synt_2 (HMM E-Value=8.1e-37) Length = 479 Score = 33.5 bits (73), Expect = 0.078 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 121 YMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDL-THNPEFTTCD 255 ++ +P+LY +M + G D+VY IG FR E + H EF D Sbjct: 252 FLAQSPQLYKQMALTGDFDKVYTIGSVFRAEDSNTHRHLTEFIGLD 297 >SB_10782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 27.1 bits (57), Expect = 6.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 178 RVYEIGRQFRNEGIDLTHNPEF 243 + + I R FRNE +D TH EF Sbjct: 251 KFFSIDRVFRNETLDATHLAEF 272 >SB_25278| Best HMM Match : wnt (HMM E-Value=8.9e-18) Length = 167 Score = 26.6 bits (56), Expect = 8.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 266 CHVKSQVVNSGLCVKSIPSFR 204 CH S N+ C KS+PSFR Sbjct: 12 CHGPSGSCNTKTCWKSVPSFR 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,458,216 Number of Sequences: 59808 Number of extensions: 284419 Number of successful extensions: 505 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 847047381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -