BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0402 (439 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 0.28 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 23 1.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 3.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 3.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 4.5 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 25.4 bits (53), Expect = 0.28 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +1 Query: 127 RIAPELYHKMLVVGGLDRVYE--IGRQFRNEGIDLTHNPEFTTCDFTWH 267 RI PELY + LVV ++ E + R +E DL F WH Sbjct: 250 RITPELYSEHLVVPEIEDNLETSLFRPLSSEATDLRMGVASFCKAFPWH 298 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 92 VMNGLAVAPPGTIFISGVSTSRKPILSK 9 VM L + P G + S KP+L K Sbjct: 12 VMTSLTLGPAGQVLAGSSSPRPKPLLKK 39 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 3.4 Identities = 6/19 (31%), Positives = 10/19 (52%) Frame = +2 Query: 305 NLVWYGTEHSWILQGQISS 361 N+ WY +W ++ I S Sbjct: 54 NITWYNEGQAWNIEANIDS 72 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 3.4 Identities = 6/19 (31%), Positives = 10/19 (52%) Frame = +2 Query: 305 NLVWYGTEHSWILQGQISS 361 N+ WY +W ++ I S Sbjct: 54 NITWYNEGQAWNIEANIDS 72 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -3 Query: 65 PGTIFISGVSTSRKPIL 15 P IF+ GV T P++ Sbjct: 694 PNVIFLQGVVTKSNPVM 710 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,824 Number of Sequences: 438 Number of extensions: 2444 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -