BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0399 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0593 + 19808148-19808310,19809416-19809531,19810129-198102... 60 1e-09 02_05_1170 + 34663853-34663928,34664038-34664078,34664317-346643... 50 1e-06 12_01_0112 - 860330-861946 30 1.6 07_02_0027 - 11963040-11963294 29 2.1 01_06_1200 - 35362412-35362432,35362526-35362715,35362799-353628... 29 2.1 07_01_0548 - 4061829-4062956 29 2.8 05_01_0002 - 8097-8246,8384-8495,8572-8735,9367-9519,9603-9732,9... 29 2.8 03_06_0110 - 31727376-31727381,31727554-31727664,31728071-317281... 29 2.8 01_01_1073 + 8456426-8456677,8457039-8457152,8457546-8457710 29 2.8 10_01_0059 + 806112-806405 29 3.7 07_01_0829 - 6703293-6703547 29 3.7 04_03_0445 - 16010516-16010770 29 3.7 02_03_0023 + 14031335-14031589 29 3.7 02_01_0211 - 1406098-1406227,1406581-1406714,1407241-1407380,140... 29 3.7 01_01_1074 + 8460072-8460326 29 3.7 11_01_0756 - 6352810-6353064 28 4.9 12_01_0355 - 2704909-2705745 28 6.5 07_01_0726 - 5543633-5543887 28 6.5 12_01_0946 + 9376037-9376318 27 8.6 02_05_0442 - 29044736-29046604 27 8.6 >07_03_0593 + 19808148-19808310,19809416-19809531,19810129-19810202, 19810286-19810335,19810498-19810592 Length = 165 Score = 60.1 bits (139), Expect = 1e-09 Identities = 35/99 (35%), Positives = 56/99 (56%), Gaps = 1/99 (1%) Frame = +2 Query: 281 VGPYSQAILADKTLYISGILGLDRDAQMVCGGAEAQTRQALDNLRHVLEAGGASLESVVK 460 +GPYSQAI A+ +++SG+LGL+ + + N+ +L+A GAS SVVK Sbjct: 69 LGPYSQAIKANNMVFVSGVLGLN--------------PEVMKNMGEILKASGASYSSVVK 114 Query: 461 TTVLLASMDDFQTFNKSMQNIFQS-LPCSNDIRXSRLPL 574 TT++LA + DF+ N+ F + P + + + LPL Sbjct: 115 TTIMLADLQDFKKVNEIYAKYFPAPAPARSTYQVAALPL 153 >02_05_1170 + 34663853-34663928,34664038-34664078,34664317-34664386, 34664499-34664647,34664784-34664879,34665406-34665476, 34665637-34665698,34665778-34665841,34665950-34666034, 34666129-34666255,34666381-34666454,34666539-34666599, 34666683-34666771,34666897-34667206,34667763-34667815, 34668299-34668370,34668648-34668914,34669015-34669047, 34669163-34669245,34669522-34669594,34669834-34670170, 34670302-34670633,34670816-34671135,34671261-34671612, 34671691-34671906 Length = 1170 Score = 50.0 bits (114), Expect = 1e-06 Identities = 35/95 (36%), Positives = 47/95 (49%), Gaps = 6/95 (6%) Frame = +2 Query: 281 VGPYSQAILADKTLYISGILGLDRDAQMVC-GGAEAQTRQALDNLRHVLEAGGASLES-- 451 +GPYSQA L + LY++G LGLD +C GG A+ AL N V A G S+ S Sbjct: 870 IGPYSQATLHGEILYMAGQLGLDPPTMKLCPGGPTAELEFALRNSEAVANAFGCSIFSSA 929 Query: 452 ---VVKTTVLLASMDDFQTFNKSMQNIFQSLPCSN 547 +V + L S + Q + + SL CSN Sbjct: 930 IHFLVYCSAHLTSSEKEQVEHTLRSSYITSLDCSN 964 >12_01_0112 - 860330-861946 Length = 538 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +2 Query: 344 LDRDAQMVCGGAEAQTRQALDNLRHVLEAGGASLESVVKT 463 ++RD+ GGA ++R+A + L+ GG ++++V KT Sbjct: 284 VERDSAASSGGANGRSRRASLSGAGALQGGGGAMQTVAKT 323 >07_02_0027 - 11963040-11963294 Length = 84 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q +V+ PD H P+V D +R ++ I Sbjct: 10 TPTRSHNIQAYVSQDTPPDIDFRDRHGYSPTVSPDTVRRYESTI 53 >01_06_1200 - 35362412-35362432,35362526-35362715,35362799-35362899, 35362985-35363116,35363204-35363302,35363493-35363568, 35363649-35363941,35364032-35364160,35364332-35364480, 35364562-35364633,35364728-35364776,35365039-35365107, 35365201-35365256,35365357-35365429,35365508-35365584, 35365847-35365934,35366086-35366259,35366358-35366473, 35366681-35366984,35367084-35367146,35367224-35367286, 35367393-35367506,35368672-35368675,35368894-35368952, 35369024-35369098,35369691-35369798,35372331-35372792 Length = 1071 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -1 Query: 556 SYVIRAGQALENILHRFVESLEVVHASQQNSSFH 455 +YVI G+AL N L + ++E VHA NS+ H Sbjct: 528 NYVI--GEALPNYLKDMISAMESVHAEVHNSTDH 559 >07_01_0548 - 4061829-4062956 Length = 375 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = -2 Query: 456 TTDSNEAPPASSTCRRLSRA*RVCASAPPQTICASRSNPRIPEMYKVLSA 307 TT + A+ LS A ++C++ PP + +NPR+ Y L A Sbjct: 5 TTTTTLPAAAALLLLLLSAAAQLCSACPPAASQTAENNPRLQRAYVALQA 54 >05_01_0002 - 8097-8246,8384-8495,8572-8735,9367-9519,9603-9732, 9802-9902,10016-10651,10820-10899,11014-11673, 11787-12041,12154-12281,12515-12669,12735-12919, 13020-13049,13164-13239,13371-13504,13703-13994, 14400-14567,14647-14745,14843-15014,15103-15281 Length = 1352 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +1 Query: 268 NISTSRSVQSSNFSGQDLIHFWNSRIGSRCTDGLRWC*SADPSG 399 NIST RSV+SS+ S + H SR G+ C SA P+G Sbjct: 816 NISTERSVESSHLSRPEQNH---SRANMEVKPGINAC-SATPAG 855 >03_06_0110 - 31727376-31727381,31727554-31727664,31728071-31728133, 31729202-31729331,31729532-31729701,31729800-31729859, 31729941-31730018,31730108-31730197,31730275-31731118, 31731220-31731281,31731362-31731423,31731511-31731700 Length = 621 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 438 APPASSTCRRLSRA*RVCASAPPQTICASRSNPR 337 APP S C ++ + C P + +C S SNP+ Sbjct: 226 APPLSEVCSKMRKLNLACREVPSRYLCQS-SNPK 258 >01_01_1073 + 8456426-8456677,8457039-8457152,8457546-8457710 Length = 176 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 12 TPTRSHNIQAYIRQDTPPDIDLKDRHGYSPTVSPDTVRRYESAI 55 >10_01_0059 + 806112-806405 Length = 97 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 10 TPTRSHNIQAYIRQDTPPDIDFRDRHGYSPTVSPDTVRRYESAI 53 >07_01_0829 - 6703293-6703547 Length = 84 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 10 TPTRSHNIQAYIRQDTPPDIDFRDRHGYSPTVSPDTVRRYESAI 53 >04_03_0445 - 16010516-16010770 Length = 84 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 10 TPTRSHNIQANIRQDTPPDIDFTDRHGYSPTVSPDTVRRYESAI 53 >02_03_0023 + 14031335-14031589 Length = 84 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 10 TPTRSHNIQAYIRQDTPPDIDFRDRHGYSPTVSPDTVRRYESAI 53 >02_01_0211 - 1406098-1406227,1406581-1406714,1407241-1407380, 1407639-1407829,1408853-1409346 Length = 362 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +2 Query: 326 ISGILGLDRDAQMVCGGAEAQTRQALDNLRHVLEAGGASLESVVKTTVLLASM 484 IS I+ D A +CG A +T + + LE A L V TTVLL+S+ Sbjct: 260 ISSIIAADTSA-FLCGRAFGRTPLTDISPKKTLEGALAGLTGCVLTTVLLSSV 311 >01_01_1074 + 8460072-8460326 Length = 84 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 10 TPTRSHNIQAYIRQDTPPDIDFKDRHGYSPTVSPDTVRRYESAI 53 >11_01_0756 - 6352810-6353064 Length = 84 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 10 TPTRSHNIQANIRQDTPPDIDFRDRHGYSPTVSPDTVRRYESAI 53 >12_01_0355 - 2704909-2705745 Length = 278 Score = 27.9 bits (59), Expect = 6.5 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = -3 Query: 452 PTPTKRHQLQVHVADCPEPDGSALQHHRRPSVHLDPIREFQKCIRSCPLKLLDCTD 285 P P R + VAD DGS+L RP R C++S LL CT+ Sbjct: 72 PPPPVRAASWIDVADDKSKDGSSLDALLRPKSSAVK-RSASFCLKSSESSLLLCTE 126 >07_01_0726 - 5543633-5543887 Length = 84 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT H +Q ++ PD H P+V D +R ++ I Sbjct: 10 TPTSSHNIQAYIRQDTPPDIDFRDRHGYSPTVSPDTVRRYESAI 53 >12_01_0946 + 9376037-9376318 Length = 93 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 449 TPTKRHQLQVHVADCPEPDGSALQHH-RRPSVHLDPIREFQKCI 321 TPT+ H +Q ++ PD H P+V D +R ++ I Sbjct: 28 TPTRSHNIQANIRQDTPPDIDFRDRHGYSPTVSPDIVRRYESAI 71 >02_05_0442 - 29044736-29046604 Length = 622 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 471 KTVVFTTDSNEAPPASSTCRRLSRA*RVCASAPPQTIC 358 +TV+ TT+ AP S RR + A A++ P T C Sbjct: 71 RTVIATTNGRAAPSQSRPRRRPAPAAAASAASLPMTFC 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,605,196 Number of Sequences: 37544 Number of extensions: 330489 Number of successful extensions: 850 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -