BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0391 (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0658 + 18447986-18448117,18448204-18448317,18448388-184485... 30 0.75 06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489... 28 4.0 03_06_0162 - 32099985-32101130,32101844-32102498,32102509-32102693 27 5.3 06_01_0142 + 1079053-1079700 27 7.0 03_06_0169 - 32125193-32125666,32125774-32126148 27 7.0 07_03_0982 + 23116343-23117089,23117227-23117313,23117424-231175... 27 9.2 >04_03_0658 + 18447986-18448117,18448204-18448317,18448388-18448507, 18448589-18449215,18449289-18449462,18449545-18449809, 18449889-18449959,18450043-18450145,18450221-18450280, 18450533-18450744,18450830-18450901,18451446-18451502, 18451598-18451882,18452359-18452371,18452396-18452463, 18452649-18452747,18452836-18452967,18453038-18453141, 18453234-18453423,18453519-18453524 Length = 967 Score = 30.3 bits (65), Expect = 0.75 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 231 DSNGIRLLDKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGQN 377 D+N +DK S C D++ DE D+T + P DN ID + N Sbjct: 467 DTNLSSEVDKLSKSCNPTDQNNDEKNDVTSAHSPKDNMDNDIDDNRNAN 515 >06_03_1450 + 30246702-30247346,30248603-30248689,30248789-30248920, 30249016-30249162,30250375-30250440,30250519-30250629, 30251551-30251584,30251667-30251743,30251829-30251906 Length = 458 Score = 27.9 bits (59), Expect = 4.0 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 365 LRVYYLNRIVKWKIIEG*IFYFVSILIIHFTQETIFIK-*SYT 240 LR+Y L + +W +++ IF F S + F I +K SYT Sbjct: 232 LRIYPLETVTRWDVLDSSIFAFWSKSSVDFEARRIRLKSNSYT 274 >03_06_0162 - 32099985-32101130,32101844-32102498,32102509-32102693 Length = 661 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 243 IRLLDKYSFLCEMYDEDADEIKDLTLNYFPF 335 + LD+ +C+MYD D I D+T+ F Sbjct: 549 VESLDELYMVCQMYDSDMKTIYDVTVYRMDF 579 >06_01_0142 + 1079053-1079700 Length = 215 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +3 Query: 309 DLTLNYFPFDNSVQIIDAKKGQNVLKRVQLPPLNLDMLPIXNIVN 443 D+ L+Y PFD +++ +V PP N +P+ V+ Sbjct: 99 DVKLHYTPFDGEPTLLNEDDASSVRTPFVQPPRNTTAIPVRVFVS 143 >03_06_0169 - 32125193-32125666,32125774-32126148 Length = 282 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 243 IRLLDKYSFLCEMYDEDADEIKDLTLNYFPF 335 + LD+ +C+MYD + + I D+T+ F Sbjct: 172 VESLDELYMVCQMYDSEMETIYDVTVYRMDF 202 >07_03_0982 + 23116343-23117089,23117227-23117313,23117424-23117555, 23118135-23118269,23118644-23118709,23118797-23118907, 23119237-23119329,23119555-23119659,23119752-23119829 Length = 517 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -1 Query: 365 LRVYYLNRIVKWKIIEG*IFYFVSILIIHFTQETIFIK-*SYT 240 LR+Y L+ + +W +++ +F F + + F + I +K SYT Sbjct: 266 LRIYPLDTLTRWDVLDSTVFAFWAKTPVDFEAKRIRLKSNSYT 308 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,776,676 Number of Sequences: 37544 Number of extensions: 130937 Number of successful extensions: 264 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -