BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0389 (436 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 24 0.85 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 6.0 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.8 bits (49), Expect = 0.85 Identities = 11/18 (61%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = +3 Query: 180 RQSGPGDRGPR-FG*SHR 230 R GPG +GPR F SHR Sbjct: 56 RNPGPGSKGPRDFPRSHR 73 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 6.0 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -3 Query: 218 AEPRTSIAGPALTMPSR---MFLPIFSIFLKIFHL 123 AE R S + P R +FL + S+F++IF+L Sbjct: 248 AEGRLSSDNMSKKSPVRKATLFLNMASVFMRIFNL 282 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,958 Number of Sequences: 438 Number of extensions: 1720 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -