BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0385 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099... 37 0.010 03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771... 30 1.2 03_05_0756 + 27469002-27469107,27469200-27469369,27470210-274710... 29 1.6 06_01_0574 + 4051723-4051805,4051913-4052366 28 4.8 01_06_1612 - 38635703-38636215,38638725-38638967 27 6.3 03_05_0431 + 24221881-24224586 27 8.4 >08_02_0021 + 11307795-11308093,11308454-11308556,11309623-11309931, 11310190-11310618 Length = 379 Score = 36.7 bits (81), Expect = 0.010 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Frame = +1 Query: 205 SEEDWHKTRNSF*SIGTRSPGRGELYNGYSGREHRTSHPLEAAADRR-NPQVRRQGPH-D 378 S ++W R SF R GRG ++ Y GR+ R P A RR P PH Sbjct: 120 SMQEWSSERCSFVQEALRGSGRGHIWAFYRGRQRRLGPPPPLPARRRLGPPPPVLVPHTP 179 Query: 379 VSAQSSAPPGLR 414 SA +++ P LR Sbjct: 180 ASAAAASHPRLR 191 >03_05_0586 - 25875703-25876332,25876426-25876713,25877064-25877194, 25877299-25877812 Length = 520 Score = 29.9 bits (64), Expect = 1.2 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 12/57 (21%) Frame = +2 Query: 173 HGPHQPRPSFGQRKTG------------TRRGILFRASERDHQDAANSIMGIVVENI 307 HGPH P P FG+ G R G L+ A R D A + + V NI Sbjct: 253 HGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDIRVAVVNI 309 >03_05_0756 + 27469002-27469107,27469200-27469369,27470210-27471001, 27471182-27471398,27471972-27472150,27472592-27472833, 27473662-27474052 Length = 698 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = -1 Query: 418 WGVVLAEQNSGQRHRVDPVSVLEDSVDQLRLPVDVRFDVLDHYTHYRVRRVLVISFRCSK 239 W + EQ SG + D S D D++ + + + + +S+ C + Sbjct: 245 WLATVPEQGSGGILQFDEASPFIDLTDEVHFDSEFGLMGIAFHPKFATNGRFFVSYNCDR 304 Query: 238 KNSSSCA 218 SS+CA Sbjct: 305 TQSSNCA 311 >06_01_0574 + 4051723-4051805,4051913-4052366 Length = 178 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 325 EAAADRRNPQVRRQGPHDVSAQSSAPP 405 EAA P+VR PHDV+ +++ PP Sbjct: 49 EAARIMCGPRVRTNFPHDVADEAAPPP 75 >01_06_1612 - 38635703-38636215,38638725-38638967 Length = 251 Score = 27.5 bits (58), Expect = 6.3 Identities = 10/24 (41%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -3 Query: 425 ISLGRSPGGAEL--WAETSCGPCL 360 + LG++ G +L W E +CGPC+ Sbjct: 177 VHLGQAAAGHDLEAWVERTCGPCV 200 >03_05_0431 + 24221881-24224586 Length = 901 Score = 27.1 bits (57), Expect = 8.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 262 VISFRCSKKNSSSCASLPLTEARTRLMRSMYF 167 V F CSK S C S L++ RT+ + M F Sbjct: 388 VCQFDCSKCASDECVSFCLSQKRTKNRKFMAF 419 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,283,834 Number of Sequences: 37544 Number of extensions: 205823 Number of successful extensions: 728 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -