BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0385 (499 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ398892-1|ABD61608.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 6.1 DQ398891-1|ABD61607.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 6.1 DQ398889-1|ABD61605.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 6.1 DQ398888-1|ABD61604.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 6.1 DQ398887-1|ABD61603.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 6.1 DQ398886-1|ABD61602.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 6.1 DQ398885-1|ABD61601.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 6.1 AE014297-3226|AAF56056.1| 2249|Drosophila melanogaster CG4792-PA... 28 6.1 DQ398890-1|ABD61606.1| 2043|Drosophila melanogaster Dicer-1 prot... 28 8.1 >DQ398892-1|ABD61608.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 >DQ398891-1|ABD61607.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 >DQ398889-1|ABD61605.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 >DQ398888-1|ABD61604.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 >DQ398887-1|ABD61603.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 >DQ398886-1|ABD61602.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 >DQ398885-1|ABD61601.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 >AE014297-3226|AAF56056.1| 2249|Drosophila melanogaster CG4792-PA protein. Length = 2249 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 459 KPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 500 >DQ398890-1|ABD61606.1| 2043|Drosophila melanogaster Dicer-1 protein. Length = 2043 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 185 QPRPSFGQR--KTGTRRGILFRASERDHQDAANSIMGIVVEN 304 +P+PS G + TRR + R RDH D ++++ ++ N Sbjct: 402 KPKPSSGASTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCN 443 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,292,022 Number of Sequences: 53049 Number of extensions: 326314 Number of successful extensions: 1084 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1763278080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -