BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0382 (598 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7TPJ7 Cluster: Ac2-210; n=3; Eutheria|Rep: Ac2-210 - R... 38 0.14 UniRef50_P18621 Cluster: 60S ribosomal protein L17; n=135; Eukar... 38 0.14 UniRef50_A7QP86 Cluster: Chromosome chr1 scaffold_136, whole gen... 37 0.41 UniRef50_Q1DNR0 Cluster: Putative uncharacterized protein; n=1; ... 36 0.96 UniRef50_Q9SV87 Cluster: NAM/NAP like protein; n=3; core eudicot... 35 1.7 UniRef50_A7RP24 Cluster: Predicted protein; n=1; Nematostella ve... 35 1.7 UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe gri... 35 1.7 UniRef50_A0UKV9 Cluster: Putative uncharacterized protein; n=2; ... 34 2.2 UniRef50_Q9BL19 Cluster: Ribosomal protein, large subunit protei... 34 2.2 UniRef50_Q8WTK4 Cluster: Ribosomal protein, large subunit protei... 34 2.2 UniRef50_A4B909 Cluster: Putative alpha amylase; n=1; Reinekea s... 33 3.9 UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2... 33 5.1 UniRef50_P23624 Cluster: Meiosis-specific protein SPO13; n=3; Sa... 33 5.1 UniRef50_Q2H526 Cluster: Putative uncharacterized protein; n=1; ... 33 6.7 UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893; ... 33 6.7 UniRef50_Q5DA16 Cluster: SJCHGC09092 protein; n=4; Schistosoma|R... 32 8.9 UniRef50_Q93VI3 Cluster: 60S ribosomal protein L17-1; n=18; Euka... 32 8.9 >UniRef50_Q7TPJ7 Cluster: Ac2-210; n=3; Eutheria|Rep: Ac2-210 - Rattus norvegicus (Rat) Length = 220 Score = 38.3 bits (85), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 510 NPAKSCKARGSNLRVHF 560 NP KSCK+RGSNLRVHF Sbjct: 10 NPTKSCKSRGSNLRVHF 26 >UniRef50_P18621 Cluster: 60S ribosomal protein L17; n=135; Eukaryota|Rep: 60S ribosomal protein L17 - Homo sapiens (Human) Length = 184 Score = 38.3 bits (85), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 510 NPAKSCKARGSNLRVHF 560 NP KSCK+RGSNLRVHF Sbjct: 10 NPTKSCKSRGSNLRVHF 26 >UniRef50_A7QP86 Cluster: Chromosome chr1 scaffold_136, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr1 scaffold_136, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 261 Score = 36.7 bits (81), Expect = 0.41 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 468 FRVKYNAN*KTGAGNPAKSCKARGSNLRVHF 560 F+VKY+ NP KSCKARG +LRVHF Sbjct: 78 FQVKYSRE----PDNPTKSCKARGLDLRVHF 104 >UniRef50_Q1DNR0 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 644 Score = 35.5 bits (78), Expect = 0.96 Identities = 30/107 (28%), Positives = 42/107 (39%), Gaps = 4/107 (3%) Frame = -1 Query: 472 RKTKNTVRTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGAS 293 RK + A + K P+ + P PE + PRRG K +R +S A Sbjct: 334 RKRRKNATRAPASDKEPLQHHKEWPESTQPGQPENTRAVKPRRGRKRRSRGSSKSSGEAF 393 Query: 292 LGNGDSVTS----NAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYST 164 G S S HR+ + L D L+ SN SD G+ +T Sbjct: 394 SDEGTSSKSTIPVTVHRICN-ISALEDMLSDKSNVSDDEHSGSHTAT 439 >UniRef50_Q9SV87 Cluster: NAM/NAP like protein; n=3; core eudicotyledons|Rep: NAM/NAP like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 341 Score = 34.7 bits (76), Expect = 1.7 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 301 GASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEY 170 G +G ++V S+ H+ + W + D L T G++ SSRG Y Sbjct: 265 GLDVGTCETVASHNHQQGLGEWAMMDRLVTCHMGNEDSSRGITY 308 >UniRef50_A7RP24 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 934 Score = 34.7 bits (76), Expect = 1.7 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = -3 Query: 488 SVIFNTENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL 321 S + + E EK+ + EL+ S HF E ++R RA+ED+ +SE ++ L Sbjct: 258 SNVQSLEEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 313 >UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 699 Score = 34.7 bits (76), Expect = 1.7 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -1 Query: 253 VLIWVWRLTDHLTTASNGSDS-SSRGTEYSTTCRTARRAYSKARMACDT 110 VLIW RLT +L AS G D+ + T +STTC S+ + CDT Sbjct: 422 VLIWTGRLTKYLAGASIGHDNINFYNTPFSTTCTCCT---SRLKDLCDT 467 >UniRef50_A0UKV9 Cluster: Putative uncharacterized protein; n=2; Burkholderia cepacia complex|Rep: Putative uncharacterized protein - Burkholderia multivorans ATCC 17616 Length = 760 Score = 34.3 bits (75), Expect = 2.2 Identities = 23/75 (30%), Positives = 35/75 (46%) Frame = -1 Query: 352 PRRGAKLNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTE 173 PRRG +++ + R L ++ HR+L+WVWR L +AS R E Sbjct: 594 PRRG-RIDHVDRLFVRRVEPLSGDVGLSGRTHRMLLWVWRAARAL-SASRAHTRRRRCRE 651 Query: 172 YSTTCRTARRAYSKA 128 + +RRA S+A Sbjct: 652 SARRTMRSRRASSRA 666 >UniRef50_Q9BL19 Cluster: Ribosomal protein, large subunit protein 17, isoform a; n=5; Eukaryota|Rep: Ribosomal protein, large subunit protein 17, isoform a - Caenorhabditis elegans Length = 187 Score = 34.3 bits (75), Expect = 2.2 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 510 NPAKSCKARGSNLRVHF 560 N KSCKARGS+LRVHF Sbjct: 12 NSTKSCKARGSDLRVHF 28 >UniRef50_Q8WTK4 Cluster: Ribosomal protein, large subunit protein 17, isoform b; n=48; Bilateria|Rep: Ribosomal protein, large subunit protein 17, isoform b - Caenorhabditis elegans Length = 159 Score = 34.3 bits (75), Expect = 2.2 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 510 NPAKSCKARGSNLRVHF 560 N KSCKARGS+LRVHF Sbjct: 12 NSTKSCKARGSDLRVHF 28 >UniRef50_A4B909 Cluster: Putative alpha amylase; n=1; Reinekea sp. MED297|Rep: Putative alpha amylase - Reinekea sp. MED297 Length = 1012 Score = 33.5 bits (73), Expect = 3.9 Identities = 20/67 (29%), Positives = 31/67 (46%) Frame = -1 Query: 391 DSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTT 212 D+ QPP + +V LNA T+ L + +GD++T N WVW+ D L Sbjct: 27 DNNQPPTI---SVESGTITLNALETTALNYSINDPDGDALTVNVTNAPTWVWQEGDQLIL 83 Query: 211 ASNGSDS 191 + D+ Sbjct: 84 SPTNPDA 90 >UniRef50_P77073 Cluster: AF/R2 fimbrial major subunit Afr2G; n=2; Escherichia coli|Rep: AF/R2 fimbrial major subunit Afr2G - Escherichia coli Length = 279 Score = 33.1 bits (72), Expect = 5.1 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -1 Query: 301 GASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTT 161 G ++ G ++ ++ +W W+L D +T ASN +D ++ T + T Sbjct: 32 GGTIDIGGTIEVDSQYDDLWTWKLGDAITVASNAADMNAEKTSLTIT 78 >UniRef50_P23624 Cluster: Meiosis-specific protein SPO13; n=3; Saccharomyces|Rep: Meiosis-specific protein SPO13 - Saccharomyces cerevisiae (Baker's yeast) Length = 291 Score = 33.1 bits (72), Expect = 5.1 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = -1 Query: 481 YLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLN 329 YL K+ NT++ I+RP D S D EQPP+ T V + +++N Sbjct: 96 YLKNKSSNTLKNERQTIERPSFDNSLR-FEDIEQPPKSTSTPVLSQSSQIN 145 >UniRef50_Q2H526 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 418 Score = 32.7 bits (71), Expect = 6.7 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +2 Query: 275 AVSVPERRSSDEYGRRARVELRSASWHRGLQELWRLFAVVVR 400 A+ V R +S E GRR ++ + +A+WHR ++ WRL V R Sbjct: 333 AIGVETRTASLEDGRR-QLGVYTAAWHRRMEHEWRLSFTVDR 373 >UniRef50_P65093 Cluster: Uncharacterized protein Rv3785/MT3893; n=14; Mycobacterium tuberculosis complex|Rep: Uncharacterized protein Rv3785/MT3893 - Mycobacterium tuberculosis Length = 357 Score = 32.7 bits (71), Expect = 6.7 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -1 Query: 229 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLL 86 TDHL D S +Y R AR + + D+GG A WL+ Sbjct: 51 TDHLEARLASLDKFSTAWDYRARARAARALHGEPVRCQDSGGGARWLI 98 >UniRef50_Q5DA16 Cluster: SJCHGC09092 protein; n=4; Schistosoma|Rep: SJCHGC09092 protein - Schistosoma japonicum (Blood fluke) Length = 414 Score = 32.3 bits (70), Expect = 8.9 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = -1 Query: 466 TKNTVRTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLG 287 TK+ V+ + I + V+ +S+ PN + +PP ++ V AK S S VRG LG Sbjct: 66 TKSAVKVET-TIPKAVSRVSRSPN--ANEPPPVVFEDVQITSAKETDESASPFVRGRGLG 122 Query: 286 NG 281 G Sbjct: 123 RG 124 >UniRef50_Q93VI3 Cluster: 60S ribosomal protein L17-1; n=18; Eukaryota|Rep: 60S ribosomal protein L17-1 - Arabidopsis thaliana (Mouse-ear cress) Length = 176 Score = 32.3 bits (70), Expect = 8.9 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 510 NPAKSCKARGSNLRVHF 560 N KSCKARG++LRVHF Sbjct: 10 NITKSCKARGADLRVHF 26 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 588,089,815 Number of Sequences: 1657284 Number of extensions: 10869156 Number of successful extensions: 33399 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 32176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33376 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -