BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0382 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) 39 0.004 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 35 0.057 SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_49937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 28 6.6 SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) 27 8.7 >SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) Length = 142 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 498 TGAGNPAKSCKARGSNLRVHF 560 T NP KSCKARGSNLRVH+ Sbjct: 6 TDPENPTKSCKARGSNLRVHY 26 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 34.7 bits (76), Expect = 0.057 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = -3 Query: 488 SVIFNTENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL 321 S + + E EK+ + EL+ S HF E ++R RA+ED+ +SE ++ L Sbjct: 326 SNVQSLEEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 381 >SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 28.3 bits (60), Expect = 5.0 Identities = 22/104 (21%), Positives = 42/104 (40%), Gaps = 1/104 (0%) Frame = -1 Query: 451 RTASYNIKRPVAD-ISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDS 275 ++ S ++ + V+ +SQ + QP + + RRG R +++ A L Sbjct: 382 QSVSQSVSQSVSQSVSQSVSQSVSQPGQNARDYWIRRGLSYLERYFFLILFNAYLHEQTF 441 Query: 274 VTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARR 143 HR W++R+ H+ G+ S + TC + R Sbjct: 442 CRWMRHRP--WIYRMLSHIDIKEKGATSEFMMRTHQPTCLVSGR 483 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -2 Query: 429 SGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRS 289 S +SP+ P RTT S ++S + R++ R +SS +RR+ Sbjct: 155 SSKSPSPPTNRTTQGESPKTSSSGHGQHSSRTAVRRSASFSSSQRRT 201 >SB_49937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 850 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +1 Query: 436 CNSLFERCFSFSVLNITLIK-KREPVTLRNHAKRVVQTSVFTFKNTYETAMAIR 594 C+S + C +V L++ +R+P +L N A R+ S + KN ETA ++ Sbjct: 657 CSSNYSLC-EVTVEESGLVRQRRQPDSLANLADRISLNSRYYLKNNNETAQLLQ 709 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 364 KTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHR 254 KTAVPRRG K S++ R + + + +TS HR Sbjct: 112 KTAVPRRGVK-GLPLNSVIRRLVDVHSSEGMTSARHR 147 >SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 344 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 457 A+W G E WRL + G++ W L ++ S G Sbjct: 62 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 99 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 344 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 457 A+W G E WRL + G++ W L ++ S G Sbjct: 78 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 115 >SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) Length = 259 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 235 RLTDHLTTASNGSDSSSRGTEYST 164 RLT++ +ASNGSD + E ST Sbjct: 2 RLTNYTLSASNGSDDETSNKEVST 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,438,649 Number of Sequences: 59808 Number of extensions: 355101 Number of successful extensions: 1009 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1009 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -