BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0379 (518 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL590103-12|CAI12136.1| 190|Homo sapiens heparan sulfate proteo... 31 3.2 BC008623-1|AAH08623.1| 147|Homo sapiens ROBO3 protein protein. 29 9.8 AK024697-1|BAB14966.1| 309|Homo sapiens protein ( Homo sapiens ... 29 9.8 >AL590103-12|CAI12136.1| 190|Homo sapiens heparan sulfate proteoglycan 2 protein. Length = 190 Score = 30.7 bits (66), Expect = 3.2 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +1 Query: 196 GYVRVVVSAIPGVSQRRLGSGDDEIISGIADTKISKSXXETAAL 327 G V V++ G RRLG+G+ ++SGIA +++ S +A+ Sbjct: 138 GSVASYVTSPQGFQFRRLGTGEPILVSGIASSRLVGSPFSVSAI 181 >BC008623-1|AAH08623.1| 147|Homo sapiens ROBO3 protein protein. Length = 147 Score = 29.1 bits (62), Expect = 9.8 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +3 Query: 174 TKGSSQTRLC--PGRRISNSRRQSTTPGIRRRRD 269 ++GSS +R PGR S SR QS PG +RR + Sbjct: 112 SRGSSSSRGSRGPGRSRSQSRSQSQRPGQKRREE 145 >AK024697-1|BAB14966.1| 309|Homo sapiens protein ( Homo sapiens cDNA: FLJ21044 fis, clone CAE11659. ). Length = 309 Score = 29.1 bits (62), Expect = 9.8 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +3 Query: 174 TKGSSQTRLC--PGRRISNSRRQSTTPGIRRRRD 269 ++GSS +R PGR S SR QS PG +RR + Sbjct: 274 SRGSSSSRGSRGPGRSRSQSRSQSQRPGQKRREE 307 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,205,596 Number of Sequences: 237096 Number of extensions: 1294266 Number of successful extensions: 2922 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2922 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -