BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0375 (352 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72840.1 68414.m08425 disease resistance protein (TIR-NBS-LRR... 28 1.5 At2g19560.1 68415.m02285 proteasome protein-related weak similar... 27 2.7 At2g43030.1 68415.m05340 ribosomal protein L3 family protein con... 27 3.5 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 27 4.6 At1g17260.1 68414.m02102 ATPase 10, plasma membrane-type, putati... 26 8.1 >At1g72840.1 68414.m08425 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1183 Score = 28.3 bits (60), Expect = 1.5 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 1 ISFIYRPFIKFLYTKNSIFYNIYWSKYNIFSTTFFRFSWNTSTIFRLSRL 150 IS + R F+ Y++ + F + +KY+I ST R SW +L ++ Sbjct: 1021 ISDLVRDFMNEEYSQEAPFRLVCITKYSIASTNNMRTSWREPMRIKLPKI 1070 >At2g19560.1 68415.m02285 proteasome protein-related weak similarity to 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit S3) (p58) (Transplantation antigen P91A) (Tum-P91A antigen) (Swiss-Prot:P14685) [Mus musculus] Length = 413 Score = 27.5 bits (58), Expect = 2.7 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 5/63 (7%) Frame = -3 Query: 191 YMNLMKKLYFMKYMSLDNLNIVEVFQLNLKNVVEKMLYL-LQ*IL*KIE----FLVYKNL 27 Y LMKK+Y + +S + QL L+ + + + +L + L ++E L+YKNL Sbjct: 328 YQRLMKKIYINQKLS----DPARAHQLKLEGIAKALRWLDMDMDLDEVECIMTILIYKNL 383 Query: 26 MKG 18 +KG Sbjct: 384 VKG 386 >At2g43030.1 68415.m05340 ribosomal protein L3 family protein contains Pfam profile PF00297: ribosomal protein L3 Length = 271 Score = 27.1 bits (57), Expect = 3.5 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 201 NREIYEPNEEIIFHEIYESG 142 N E +EPN++++F EI++ G Sbjct: 141 NIEGFEPNQKLVFDEIFKEG 160 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 26.6 bits (56), Expect = 4.6 Identities = 14/48 (29%), Positives = 31/48 (64%) Frame = -3 Query: 158 KYMSLDNLNIVEVFQLNLKNVVEKMLYLLQ*IL*KIEFLVYKNLMKGL 15 K + L+N + V + Q++L+N+V++ L + + ++ L +KN++K L Sbjct: 36 KGLDLENGDFVAIKQVSLENIVQEDLNTIMQEIDLLKNLNHKNIVKYL 83 >At1g17260.1 68414.m02102 ATPase 10, plasma membrane-type, putative / proton pump 10, putative / proton-exporting ATPase, putative strong similarity to SP|Q43128 ATPase 10, plasma membrane-type (EC 3.6.3.6) (Proton pump 10) {Arabidopsis thaliana}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00690: Cation transporter/ATPase, N-terminus Length = 947 Score = 25.8 bits (54), Expect = 8.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 14 TGLSLNSYILKIQFFTIFIGVNITFFPQHF 103 TG+ + +Y+ + +I V+ TFF +HF Sbjct: 719 TGIVIGTYLALVTVLFYWIIVSTTFFEKHF 748 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,916,231 Number of Sequences: 28952 Number of extensions: 89231 Number of successful extensions: 207 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 439384704 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -