BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0370 (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.58 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 22 3.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 3.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 3.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.1 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.58 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 501 YYFISFLFGLLKIHIF*FQISIFTTVHII 415 YYF+ LF LL I+ F IF TVH++ Sbjct: 134 YYFVVPLFFLLCIYYFYCAFIIF-TVHLL 161 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 504 TYYFISFLFGLLKIHIF*FQISIFTTVHII 415 TYYF LL ++ F + IF TVH++ Sbjct: 100 TYYFYYAFIILLCVYYFYYAFIIF-TVHLL 128 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 110 EKNPCIQPPLVCPKNTEHRXRHAGKXACC 196 E+ PCI C KNT R A CC Sbjct: 86 EREPCIAGSAPCRKNT---GRCAFDGICC 111 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -2 Query: 169 GAMLSVLRANKWWLYAW-----IFFTVVCTTYQSTVRL 71 GA ++ + + W + + +FF +VC T +S ++L Sbjct: 933 GAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQL 970 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -2 Query: 169 GAMLSVLRANKWWLYAW-----IFFTVVCTTYQSTVRL 71 GA ++ + + W + + +FF +VC T +S ++L Sbjct: 933 GAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQL 970 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -2 Query: 169 GAMLSVLRANKWWLYAW-----IFFTVVCTTYQSTVRL 71 GA ++ + + W + + +FF +VC T +S ++L Sbjct: 933 GAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQL 970 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -2 Query: 169 GAMLSVLRANKWWLYAW-----IFFTVVCTTYQSTVRL 71 GA ++ + + W + + +FF +VC T +S ++L Sbjct: 933 GAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQL 970 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,779 Number of Sequences: 336 Number of extensions: 2750 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -