BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0370 (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|ch... 29 0.45 SPBC13A2.03 |||phosphatidate cytidylyltransferase|Schizosaccharo... 27 2.4 SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting... 25 7.3 SPAC22E12.07 |rna1||Ran GAP Rna1|Schizosaccharomyces pombe|chr 1... 25 9.7 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 25 9.7 >SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 29.1 bits (62), Expect = 0.45 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 96 VQTTVKKIHAYSHHLFALRTL 158 ++ VKKIH ++H +F LRTL Sbjct: 63 LKVAVKKIHPFNHPVFCLRTL 83 >SPBC13A2.03 |||phosphatidate cytidylyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 439 Score = 26.6 bits (56), Expect = 2.4 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Frame = +3 Query: 75 RTVLWYVVQTTV-----KKIHAYSHHLFAL 149 R + WY + TT+ + I+AY HHLF + Sbjct: 109 RFINWYFLMTTLYYAYGESIYAYFHHLFIM 138 >SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting complex subunit Apc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 25.0 bits (52), Expect = 7.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 392 IIFRTGRDRSIASLYFPANENDYTSLVQTLLMHLR 288 +I + G + S+ +LY P +ND S+V M R Sbjct: 230 LICKGGTNISLKTLYMPLLKNDLGSIVDIATMSTR 264 >SPAC22E12.07 |rna1||Ran GAP Rna1|Schizosaccharomyces pombe|chr 1|||Manual Length = 386 Score = 24.6 bits (51), Expect = 9.7 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = +1 Query: 376 PVRNIICVRNKIDN 417 P+R+IIC RN+++N Sbjct: 160 PLRSIICGRNRLEN 173 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 24.6 bits (51), Expect = 9.7 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 242 YSKEQAKPPPLCVRSLSNASKEFALSLCS-RFH*QENISLQYFYHDLF 382 Y+K+ K P V SLS K F L + + R + QE + F LF Sbjct: 983 YTKKNPKEPTADVNSLSYFEKFFVLFVVNLRHYFQERMKALKFRSTLF 1030 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,162,127 Number of Sequences: 5004 Number of extensions: 40220 Number of successful extensions: 102 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -