BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0370 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 24 0.88 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.2 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 6.2 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 8.2 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 24.2 bits (50), Expect = 0.88 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +2 Query: 8 VFKNFKMKTLIFIMLVACVASEXYGAL 88 +FK FK + +++++ AC+ E + L Sbjct: 431 LFKTFKDRKYLYMLMEACLGGELWTVL 457 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 341 QENISLQYFYHDL-FEI*FVYGIKLIIICTV 430 ++N+ + Y D + I F Y I LI++CTV Sbjct: 802 EDNLLVCNSYVDASYMIAFAYPIMLIVVCTV 832 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 274 VCKEPLKCIKRVCTKL 321 + K PL+C+ R CT + Sbjct: 106 ITKAPLECMCRPCTSV 121 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -3 Query: 513 PVNTYYFISFLFGLLKIHIF*FQISIFTTVHIII 412 P T+ LFG++ ++ F + I+T I++ Sbjct: 196 PTYTHEITYSLFGMIMMYWFPLVVIIYTYTSILL 229 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,646 Number of Sequences: 438 Number of extensions: 2933 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -