BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0368 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical ... 31 0.62 AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical ... 31 0.62 Z81567-5|CAB04588.2| 154|Caenorhabditis elegans Hypothetical pr... 30 1.1 Z83108-2|CAB05510.1| 820|Caenorhabditis elegans Hypothetical pr... 29 3.3 >AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical protein Y59A8B.9 protein. Length = 187 Score = 31.1 bits (67), Expect = 0.62 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -3 Query: 224 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGXPSMSPQKGSPA 93 GPA GA +PSR + +P +T R P+ P+ P + +P+ Sbjct: 14 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPS 57 >AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical protein Y59A8B.7 protein. Length = 316 Score = 31.1 bits (67), Expect = 0.62 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -3 Query: 224 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGXPSMSPQKGSPA 93 GPA GA +PSR + +P +T R P+ P+ P + +P+ Sbjct: 143 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPS 186 >Z81567-5|CAB04588.2| 154|Caenorhabditis elegans Hypothetical protein K08C9.7 protein. Length = 154 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = -3 Query: 197 SPSRKHFLFICVEPGSTPRCPSGXPSMSPQKGSPASQPYTLNR 69 SPS K+F E G R P+G P++S Q+ + +QP TL + Sbjct: 107 SPSPKYFKID--ENGKISRLPTGIPTVSIQREAFMTQPTTLRK 147 >Z83108-2|CAB05510.1| 820|Caenorhabditis elegans Hypothetical protein F44E5.2 protein. Length = 820 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 2 CGAHVFACVVNFFG-CSRLPP 61 C H+F C + FFG CSR P Sbjct: 555 CDRHIFRCSIPFFGFCSRCEP 575 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,601,076 Number of Sequences: 27780 Number of extensions: 318436 Number of successful extensions: 859 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -