BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0366 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 1.4 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 1.9 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 3.2 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 24 4.3 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 5.7 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 5.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.9 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 1.4 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 97 PPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 219 PPP+ + + + L + T E V ++C E G I+ P Sbjct: 756 PPPKPPTVTMMDMQQLDTQPTLEFKELVSQKCAERGIIFAP 796 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.0 bits (52), Expect = 1.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 402 CACDRNDSCMAMRGDHI 352 C C N +CM M GD + Sbjct: 776 CPCPNNGACMQMAGDTV 792 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 360 DHIA--PSEREVPCRPTFVRPSCPGLLQRHDARKTSRS 253 DH++ P REV R + + LL+ H KTS++ Sbjct: 806 DHLSWLPHVREVTTRARKIADAVTRLLRNHSGPKTSKA 843 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.8 bits (49), Expect = 4.3 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 329 PAVQHSSVHRVQGFFSVTTLEKPHEAN 249 P H S HR+ G F + + P++ + Sbjct: 32 PRSPHGSGHRIVGGFEINVSDTPYQVS 58 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 81 NELRKTSATNRWHGLV 128 N L T+ATNR+ GLV Sbjct: 426 NGLHSTTATNRFSGLV 441 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 321 PTFVRPSCPGLLQRHDARKTSRSESSTFPCV 229 P F P C G ++++ + + S+TF V Sbjct: 57 PNFTHPRCHGQIEKYCPEEYTVDPSNTFQLV 87 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 356 ISRHLNAKFPAVQHSSVHRVQGFFSVTTLE 267 I+ HL+A F AV+H + + + T ++ Sbjct: 424 INIHLHALFSAVEHGHLEKARTILESTDVD 453 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,926 Number of Sequences: 2352 Number of extensions: 10715 Number of successful extensions: 27 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -