BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0365 (648 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2GKW9 Cluster: Type IV secretion systemprotein, VirB6 ... 35 2.0 UniRef50_Q4CTL7 Cluster: Putative uncharacterized protein; n=1; ... 33 7.9 >UniRef50_Q2GKW9 Cluster: Type IV secretion systemprotein, VirB6 family; n=1; Anaplasma phagocytophilum HZ|Rep: Type IV secretion systemprotein, VirB6 family - Anaplasma phagocytophilum (strain HZ) Length = 1477 Score = 34.7 bits (76), Expect = 2.0 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +2 Query: 437 INKKHYGMTLHRM*VLLADECCKKTEI*GELIL--GS*KRXG*AKKSNGCIIIHVKEVFK 610 I+++H + H V+ DE CKKT EL L + + G K ++HVK+ Sbjct: 132 ISREHSPVIFHNNEVIFRDEACKKTVAIEELCLSGATSEVLGDGSKKG---LLHVKDAKG 188 Query: 611 ECKSLPS 631 ECK +P+ Sbjct: 189 ECKEVPA 195 >UniRef50_Q4CTL7 Cluster: Putative uncharacterized protein; n=1; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 2351 Score = 32.7 bits (71), Expect = 7.9 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +1 Query: 307 IIVQEHDSQPQEKVCSTTKDVFWDRSKIRLLLKLCLEDRFKNINKQKTLWHDIASHVGTT 486 +++Q E+ CS ++D W RS I LL K+ L K I +L+ + H+ Sbjct: 359 LLIQTEKESSSERECSNSQDNLWLRSAISLLFKVVLAS--KKIETLLSLFRWVYRHLKIA 416 Query: 487 G 489 G Sbjct: 417 G 417 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 592,670,188 Number of Sequences: 1657284 Number of extensions: 11111195 Number of successful extensions: 25584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25571 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -