BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0359 (448 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 1.7 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 4.0 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 4.0 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 4.0 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 7.0 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 7.0 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 7.0 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 7.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 7.0 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 20 9.3 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 6/32 (18%) Frame = +3 Query: 225 SPTA*ARRLVP------NQCRIMGYRTCCCPN 302 SPTA A L P +Q R G TC CPN Sbjct: 264 SPTAGAGGLPPQVPSPRSQRRYTGRATCDCPN 295 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 4.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 148 PVRIQGAHTSGPGQ*CSRFYVQELEAAL 231 PVRI G H G C++ E AL Sbjct: 196 PVRIMGVHRPGFDNDCNKNTSTSKEIAL 223 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 4.0 Identities = 16/52 (30%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +2 Query: 125 VQGAAKPLPFVFKAPIRPDLVNDVHVSM--SKNSRQPYCVSKEAGPKPVPNH 274 + AA PL + P L V+ S + P V E P PVP H Sbjct: 279 ITSAATPLVRSYAPERYPPLAQGVNDDAFNSVATPTPTSVMTELYPSPVPGH 330 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 134 HPAPSHSSLNTPTL 93 HPA +HS+L +P + Sbjct: 121 HPAAAHSALLSPAM 134 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 20.6 bits (41), Expect = 7.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 121 DGAGCSQAPPVRIQGAHTSGP 183 + + S PP+ I GA +GP Sbjct: 300 EDSSISGVPPLSIDGALEAGP 320 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 20.6 bits (41), Expect = 7.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 236 VSKEAGPKPVPNH 274 + E GPK PNH Sbjct: 199 IPPENGPKMTPNH 211 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 20.6 bits (41), Expect = 7.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 236 VSKEAGPKPVPNH 274 + E GPK PNH Sbjct: 199 IPPENGPKMTPNH 211 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 20.6 bits (41), Expect = 7.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 236 VSKEAGPKPVPNH 274 + E GPK PNH Sbjct: 199 IPPENGPKMTPNH 211 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 20.6 bits (41), Expect = 7.0 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 Query: 325 YHHHGHAEFGQQHV 284 +HH GH Q HV Sbjct: 323 HHHAGHHIHAQHHV 336 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/39 (20%), Positives = 15/39 (38%) Frame = +2 Query: 143 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGPK 259 P+PF + + + + + + K PY G K Sbjct: 312 PVPFALRPAVDATIQEMLDLGVIKREASPYASPMTVGKK 350 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,154 Number of Sequences: 336 Number of extensions: 2429 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10090848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -