BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0353 (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 29 0.45 SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pomb... 26 4.2 SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo... 26 4.2 SPBC16D10.10 |||tRNA specific adenosine deaminase subunit Tad2 |... 25 5.6 SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe... 25 5.6 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 25 9.7 SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch... 25 9.7 SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su... 25 9.7 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 29.1 bits (62), Expect = 0.45 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 264 FEVT-LSPFPSDAPLTSMDVERALSFAPRRGTAVFKSSG 377 FEV LS FPSD T +ER+ R GTAVF+S+G Sbjct: 1371 FEVNGLSHFPSDIEDT---IERSHPRIARGGTAVFQSAG 1406 >SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pombe|chr 3|||Manual Length = 323 Score = 25.8 bits (54), Expect = 4.2 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 487 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 374 S+ LTRK +NT R+ + PV ++ + +S PP Sbjct: 228 SIMLTRKLENTTRSDQGYLASPVPFLNGNEPANSGLPP 265 >SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1588 Score = 25.8 bits (54), Expect = 4.2 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 432 LSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEE 298 +S Q N +T NS +++ AE SST + PY S + Sbjct: 155 ISSQQKFHGNDKTLEKNSAKATINKSNSTAETSSTATVEPYDSND 199 >SPBC16D10.10 |||tRNA specific adenosine deaminase subunit Tad2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 25.4 bits (53), Expect = 5.6 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = -2 Query: 535 RALHDFARVSGSRFLISVYLTRKTKNTVRTASYNIKRPVADISQH 401 + L+DF +S + S++ TR+ + + NI + +SQH Sbjct: 147 KVLNDFVTLSKPAYDSSIHPTRENADIILPQKENIDTALLFVSQH 191 >SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe|chr 3|||Manual Length = 396 Score = 25.4 bits (53), Expect = 5.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 487 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 374 S+ LTRK +N VR+ + PV ++ D E PP Sbjct: 301 SMMLTRKYENMVRSDMHYSAVPVPFLNGDEPRDYELPP 338 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 24.6 bits (51), Expect = 9.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 383 TASRALEDRGATTRSEAQRAL 321 +AS LEDR A ++EAQR + Sbjct: 1221 SASSNLEDRAARIKAEAQRRM 1241 >SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1480 Score = 24.6 bits (51), Expect = 9.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 20 SSGTSSIPKFHSSLQDLKQPSLQEPR 97 S T+S K H S LK+ S EPR Sbjct: 255 SDETNSFSKLHQSQFGLKEESSHEPR 280 >SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Sum3|Schizosaccharomyces pombe|chr 3|||Manual Length = 636 Score = 24.6 bits (51), Expect = 9.7 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 342 ERSSTRALRPYSSEERRSGTETA*LQTPIEFSFGYGG 232 ++ S A +E S ++ QTP EFS YGG Sbjct: 37 DKPSAGAAPAVGDDESVSSRGSSRSQTPSEFSSNYGG 73 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,182,082 Number of Sequences: 5004 Number of extensions: 38610 Number of successful extensions: 145 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -