BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0351 (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.02c |mcl1|slr3|DNA polymerase alpha accessory factor Mc... 29 0.39 SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|ch... 27 1.6 SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce... 27 2.1 SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,... 26 2.7 SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharom... 26 2.7 SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual 25 6.3 SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosa... 25 8.4 SPCC1223.08c |dfr1||dihydrofolate reductase Dfr1|Schizosaccharom... 25 8.4 SPBC2F12.15c |||palmitoyltransferase|Schizosaccharomyces pombe|c... 25 8.4 >SPAPB1E7.02c |mcl1|slr3|DNA polymerase alpha accessory factor Mcl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 815 Score = 29.1 bits (62), Expect = 0.39 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 2/82 (2%) Frame = +1 Query: 214 C*SKSPNSTSRDKIVVETG-ENRQFIHINEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKI 390 C + +P++++ ++ E N+ F+ + E I + D EK+ + D++ + Sbjct: 704 CNTNNPDASTSVPVLEELQLRNKLFLTLLEDSI--GDGDVTEDEKISIARLEANIDKALL 761 Query: 391 RLLLKLCLEDRFKNINK-QKTL 453 +L+ K CLE+R + + + KTL Sbjct: 762 QLIQKACLEERIERVYELTKTL 783 >SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 684 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 333 LAIMFLYDYRRFIYVDKLSIFSCFYYD 253 L + F Y Y +F++V + S S +YY+ Sbjct: 205 LKLFFRYQYSQFLFVYRESFLSDYYYN 231 >SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 983 Score = 26.6 bits (56), Expect = 2.1 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 1/89 (1%) Frame = +1 Query: 214 C*SKSPNSTSRDKIVVETGENRQFIHINEPPIIVQEHDSQPQEKVCST-TKDVFWDRSKI 390 C S +PN +R +VVE E I + + + PQ+++ K+ WD Sbjct: 687 CFSDTPNKKNRITMVVEPLEKGISNDIENGKVNI----NWPQKRISEFFQKNYDWDLLAS 742 Query: 391 RLLLKLCLEDRFKNINKQKTLWHDIASHV 477 R + +DR NI + TL D+ +V Sbjct: 743 RSIWAFGPDDRGTNILRDDTLSTDVDKNV 771 >SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,3-glucosyltransferase Alg12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 546 Score = 26.2 bits (55), Expect = 2.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -2 Query: 390 YFASIPKDVFSSTTNFFLWLAIMFLYDYRRFIYVDKLSIF 271 YF +P + TT FL ++ +++ R IYV IF Sbjct: 254 YFVRLPWLFLNPTTLLFLLISFVYIKPARLLIYVPLFFIF 293 >SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 26.2 bits (55), Expect = 2.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 23 PCNYVYKVFILNTILLFFRTLSCKY 97 P + ++ I+NTI++ F T+ C Y Sbjct: 30 PLTWPIRIRIINTIIISFMTMLCMY 54 >SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 25.0 bits (52), Expect = 6.3 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +2 Query: 134 MNNPPNQSYWFVLREDQSNVILSTNNFVNQN 226 M N P+ YW L S ++ ++ N+++ + Sbjct: 121 MANDPSMKYWLKLTNQLSGLLCASLNYIDSS 151 >SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 466 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +2 Query: 149 NQSYWFVLREDQSNVILSTNNFVNQNPQIPLQ 244 N+S W + +++ +I + N ++ NP P+Q Sbjct: 306 NRSPWTI--QEKEKLIKTVNQYLQSNPSSPIQ 335 >SPCC1223.08c |dfr1||dihydrofolate reductase Dfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 461 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -3 Query: 311 IIGGSFMWINCLFSPVSTTIL 249 IIGGSF++ + L+ P++ +L Sbjct: 363 IIGGSFLYGSALYHPLTKNLL 383 >SPBC2F12.15c |||palmitoyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 350 QTFSCGWLSCSCTIIGGS-FMWI 285 Q F+ GW C I+G S F+W+ Sbjct: 230 QPFNVGWYENWCQIMGKSPFLWL 252 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,038,125 Number of Sequences: 5004 Number of extensions: 40503 Number of successful extensions: 107 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -