BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0351 (499 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78059-1|CAH04725.2| 348|Caenorhabditis elegans Hypothetical pr... 29 1.9 AF067217-1|AAY55828.1| 191|Caenorhabditis elegans Hypothetical ... 28 4.3 Z92780-2|CAB07177.1| 115|Caenorhabditis elegans Hypothetical pr... 27 7.6 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 27 7.6 Z69637-2|CAA93466.1| 199|Caenorhabditis elegans Hypothetical pr... 27 10.0 >Z78059-1|CAH04725.2| 348|Caenorhabditis elegans Hypothetical protein C34B4.5 protein. Length = 348 Score = 29.1 bits (62), Expect = 1.9 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +2 Query: 32 YVYKVFILNTILLFFRTLSCKYL*LFRYFSLKMDMNNPPNQSYWFVLREDQSNVILSTNN 211 +V +F+L+T+ T S + +F + LK P + +WF+L+ S ILST N Sbjct: 43 FVILLFVLSTVTATLLTASFLIMAVFLWNHLK------PMKFFWFLLQLTISAFILSTLN 96 Query: 212 FVNQNP 229 V P Sbjct: 97 LVFNVP 102 >AF067217-1|AAY55828.1| 191|Caenorhabditis elegans Hypothetical protein F56A6.5 protein. Length = 191 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +1 Query: 292 INEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKIRLLLKLC----LEDRFKNINKQKTLW 456 + E I E+D Q T DR +++LL K C E+ F+ N ++LW Sbjct: 3 VTECSICYDEYDHDTQIPCIGTCGHTICDRCRLQLLNKRCPHCKRENAFERKNVNRSLW 61 >Z92780-2|CAB07177.1| 115|Caenorhabditis elegans Hypothetical protein C45G3.4 protein. Length = 115 Score = 27.1 bits (57), Expect = 7.6 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 220 SKSPNSTSRDKIVVETGENR--QFIHINEPPIIVQEHDSQPQEKV 348 S SP TS + I+ ++ R Q PIIV+ +D PQ K+ Sbjct: 64 SSSPRPTSSNSIIQKSDGKRKDQKNEKQASPIIVEVYDDTPQSKL 108 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 27.1 bits (57), Expect = 7.6 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 110 RYFSLKMDMNNPPNQSYWFVLREDQSN 190 + FS+ +M+ PP YW + E +SN Sbjct: 304 KQFSIPHNMDRPPAPRYWIIDNEVRSN 330 >Z69637-2|CAA93466.1| 199|Caenorhabditis elegans Hypothetical protein F35G2.2 protein. Length = 199 Score = 26.6 bits (56), Expect = 10.0 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -2 Query: 141 LFISIFNEKYLNNYKYLHDSVLKNRRIVFSMKTL 40 LF+ EK+ +N KY + + +RR++ + + L Sbjct: 17 LFVCDLQEKFASNIKYFPEIITTSRRLIDAARIL 50 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,167,078 Number of Sequences: 27780 Number of extensions: 221912 Number of successful extensions: 565 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -