BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0350 (399 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_35985| Best HMM Match : Sushi (HMM E-Value=2.4) 27 5.6 >SB_56012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 27.5 bits (58), Expect = 4.3 Identities = 16/68 (23%), Positives = 34/68 (50%) Frame = +3 Query: 48 QSNVILSTNNFVNXNPQIPLQETRYVVXTGENRQFIHINEPPIIVQEHDSQPQXKVCSTT 227 +S+ I S+ N + NP+ T + E R+F + P I ++E + + ++C+++ Sbjct: 225 RSHSIASSQNNNHTNPK---PGTNISPGSPERREFAQVTGPRIEIEEDPERIEIQICASS 281 Query: 228 KDVFWDRS 251 + D S Sbjct: 282 TSIEQDPS 289 >SB_35985| Best HMM Match : Sushi (HMM E-Value=2.4) Length = 391 Score = 27.1 bits (57), Expect = 5.6 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = -2 Query: 236 DVFSSTTNFXLWLAIMFLYDYRRFIYVDKLSIFSC---XYYVSCLLKWNLGIXINK 78 D +S T W F+ Y FI VD+ S+F+C +C+ +W++ +++ Sbjct: 58 DRWSVFTCVDRWSVFTFVDCYSVFICVDRWSLFTCVDRWSVFTCVDRWSVFTCVDR 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,239,951 Number of Sequences: 59808 Number of extensions: 130635 Number of successful extensions: 496 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -