BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0348 (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 5.2 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 6.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 6.9 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.9 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 20 9.1 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 5.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 297 EFGQQHVRYPMIXHCLVTSXLAXAVGLPRVL 205 +FG+ +V+Y L T LA AV VL Sbjct: 285 QFGENNVQYQGSEDILNTQSLAKAVSKNGVL 315 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 20.6 bits (41), Expect = 6.9 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = +1 Query: 178 VNDVHVSMSKNSRQPYCVSKXAGHQTVPNHGVP 276 + DV + Y ++ +G +P HG+P Sbjct: 417 LTDVFHVQETDKYDAYYGNRFSGEYEIPAHGLP 449 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 20.6 bits (41), Expect = 6.9 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +1 Query: 217 QPYCVSKXAGHQTVPNHGVPDV 282 QP V++ P HG P V Sbjct: 259 QPVTVNRQLNSDVQPGHGSPPV 280 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 6.9 Identities = 6/20 (30%), Positives = 10/20 (50%) Frame = -3 Query: 376 RTYXHXDTCYRRHPEXDQWV 317 R + D C R +P +W+ Sbjct: 712 RLHYETDPCVRYYPRRKEWL 731 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 20.2 bits (40), Expect = 9.1 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 154 KAPIRPDXVNDVHVSMSKNSRQPY 225 K P++ + D+ + M RQP+ Sbjct: 59 KLPVKAITLPDLSIPMQLGRRQPF 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,248 Number of Sequences: 438 Number of extensions: 1727 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -