BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0347 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces ... 28 0.90 SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 26 4.8 >SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 390 Score = 28.3 bits (60), Expect = 0.90 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 274 CGTVREVV*SPPLPAAWVQRMALSCSRLHGNTSCLFVLSL 155 CGT V + W+ +AL+ SR +GNT L L L Sbjct: 173 CGTQVFVGSGRSIDCQWMDSVALNLSRYYGNTEALSSLPL 212 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 25.8 bits (54), Expect = 4.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 416 LIAFGCVRVVENXINAGQFPLYNW 487 L+ FGC+R+ EN F + NW Sbjct: 1642 LLPFGCIRLSENNEVRKAFSVSNW 1665 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,504,295 Number of Sequences: 5004 Number of extensions: 49968 Number of successful extensions: 131 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -