BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0347 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16460.1 68418.m01924 hypothetical protein similar to unknown... 29 1.8 At1g75620.1 68414.m08786 glyoxal oxidase-related contains simila... 28 5.4 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 27 7.2 At5g66130.1 68418.m08331 cell cycle checkpoint protein-related w... 27 9.5 At4g28840.1 68417.m04122 expressed protein 27 9.5 At2g23450.2 68415.m02800 protein kinase family protein contains ... 27 9.5 At2g23450.1 68415.m02799 protein kinase family protein contains ... 27 9.5 >At5g16460.1 68418.m01924 hypothetical protein similar to unknown protein (pir||T02326) Length = 368 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 258 SRTVPHTYPSSVTLNSEPRWLLSTANN 338 +RT+P Y + + +NS+P W+ A N Sbjct: 261 TRTLPQLYEAEIVINSKPPWIKRMAYN 287 >At1g75620.1 68414.m08786 glyoxal oxidase-related contains similarity to glyoxal oxidase precursor [Phanerochaete chrysosporium] gi|1050302|gb|AAA87594 Length = 547 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 264 TVPHTYPSSVTLNSEPRWLLSTANNSVAEVFKGPMFPSDL 383 T+P Y S TL + R L+ +N F G +FP++L Sbjct: 384 TIPRMYHSIATLLRDGRILVGGSNPHAFYNFTGVLFPTEL 423 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 7/45 (15%) Frame = -3 Query: 281 VGMWNSARGRLVTAATGSMGP-------ADGALLLSPSRKHFLFI 168 V +WN G+ VT G +GP AD LLLS S+ L I Sbjct: 384 VRLWNGITGQFVTVFRGHVGPVYQVSWSADSRLLLSGSKDSTLKI 428 >At5g66130.1 68418.m08331 cell cycle checkpoint protein-related weak similarity to cell cycle checkpoint protein RAD17 [Homo sapiens] GI:4102916 Length = 599 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 472 ELPRIDXVFNHSNASESDQTKVQNVETN*IKSLGNIGPLKTS 347 ++P + + +H+NA SDQT + +T SL G LK + Sbjct: 247 QIPTVILITDHNNADSSDQTARRMEDTQ--SSLERAGALKVA 286 >At4g28840.1 68417.m04122 expressed protein Length = 146 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 155 GSTPRCPSGTPSMSPQKGSPASQPYTLNRN 66 G P PS +PS S SP PY + N Sbjct: 84 GGYPSIPSSSPSFSYASSSPPPAPYGFHPN 113 >At2g23450.2 68415.m02800 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 708 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 275 MWNSARGRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTP 144 +W R L+T G++G GA LL+ F F C STP Sbjct: 275 VWRHCRSNLITIVGGTVG---GAFLLAALA--FFFFCKRRRSTP 313 >At2g23450.1 68415.m02799 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 708 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 275 MWNSARGRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTP 144 +W R L+T G++G GA LL+ F F C STP Sbjct: 275 VWRHCRSNLITIVGGTVG---GAFLLAALA--FFFFCKRRRSTP 313 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,401,288 Number of Sequences: 28952 Number of extensions: 271817 Number of successful extensions: 734 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -