BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0344 (323 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) 119 4e-28 At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si... 112 4e-26 At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identic... 30 0.31 At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identic... 30 0.31 At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identic... 30 0.31 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 0.94 At4g28730.1 68417.m04109 glutaredoxin family protein contains gl... 27 2.2 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 3.8 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 3.8 At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) fa... 26 6.7 At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340... 25 8.8 At3g18290.1 68416.m02326 zinc finger protein-related weak alignm... 25 8.8 At3g12120.1 68416.m01508 omega-6 fatty acid desaturase, endoplas... 25 8.8 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 25 8.8 >At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) Length = 92 Score = 119 bits (287), Expect = 4e-28 Identities = 51/76 (67%), Positives = 60/76 (78%) Frame = +3 Query: 27 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 206 MAKRTKKVGI GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK +KR VGIW CK C Sbjct: 1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDC 60 Query: 207 KRTVAGGAWVFSTTAA 254 + AGGA+ +T +A Sbjct: 61 GKVKAGGAYTMNTASA 76 >At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) similar to putative 60S ribosomal protein L37a GB:AAD28753 [Gossypium hirsutum] Length = 92 Score = 112 bits (270), Expect = 4e-26 Identities = 49/76 (64%), Positives = 57/76 (75%) Frame = +3 Query: 27 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 206 M KRTKK I GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR VGIW CK C Sbjct: 1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60 Query: 207 KRTVAGGAWVFSTTAA 254 + AGGA+ +T +A Sbjct: 61 GKVKAGGAYTMNTASA 76 >At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 545 Score = 30.3 bits (65), Expect = 0.31 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 11 GEVYQNGQTYQKGWNYW 61 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 428 Score = 30.3 bits (65), Expect = 0.31 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 11 GEVYQNGQTYQKGWNYW 61 G Y +G+TYQ W+YW Sbjct: 180 GSCYSSGETYQPRWDYW 196 >At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 516 Score = 30.3 bits (65), Expect = 0.31 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 11 GEVYQNGQTYQKGWNYW 61 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 28.7 bits (61), Expect = 0.94 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 179 CRHLVL*AMQEDCSRRSLGILHYCCPSCRSAVRRLREVK 295 CRHL M DC++ L + CP CR + L E+K Sbjct: 317 CRHL---CMCSDCAKE-LRLQSNKCPICRQPIEELLEIK 351 >At4g28730.1 68417.m04109 glutaredoxin family protein contains glutaredoxin domain, Pfam:PF00462 Length = 174 Score = 27.5 bits (58), Expect = 2.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 57 TGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC 152 + +G+R S+RK V + V ++K CS+C Sbjct: 62 SSSFGSRMEESIRKTVTENTVVIYSKTWCSYC 93 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 26.6 bits (56), Expect = 3.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 232 QAPPATVLLHRLQDQMPTQERF 167 + PP TVL+ +LQ+ + + ERF Sbjct: 802 KVPPMTVLIQKLQNALSSLERF 823 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 26.6 bits (56), Expect = 3.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 232 QAPPATVLLHRLQDQMPTQERF 167 + PP TVL+ +LQ+ + + ERF Sbjct: 875 KVPPMTVLIQKLQNALSSLERF 896 >At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 383 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 209 EDCSRRSLGILHYCCPSCRSA 271 + C +RSL I H CP C +A Sbjct: 352 QQCIQRSLEIRHRKCPGCGTA 372 >At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340: Protein of unknown function (DUF740) Length = 521 Score = 25.4 bits (53), Expect = 8.8 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +2 Query: 23 QNGQTYQKGWNYW 61 ++G+ + KGWN+W Sbjct: 347 KSGKNWSKGWNFW 359 >At3g18290.1 68416.m02326 zinc finger protein-related weak alignment to Pfam profiles: PF00097 Zinc finger, C3HC4 type (RING finger) (2 copies) Length = 1254 Score = 25.4 bits (53), Expect = 8.8 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -2 Query: 241 ENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTS 113 E Q P + + ++Q RF+ S+P N F W++S Sbjct: 177 EQKQVFPLLIEKFKYEEQAYIVWRFLCSIPVNMLAVFLPWISS 219 >At3g12120.1 68416.m01508 omega-6 fatty acid desaturase, endoplasmic reticulum (FAD2) / delta-12 desaturase identical to omega-6 fatty acid desaturase, endoplasmic reticulum (FAD2) SP:P46313 [Arabidopsis thaliana (Mouse-ear cress)] (Plant Cell 6:147-158(1994)) Length = 383 Score = 25.4 bits (53), Expect = 8.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 189 WSCKRCKRTVAGGAWVFSTTAAHHA 263 W+C+ C T G WV + HHA Sbjct: 90 WACQGCVLT---GIWVIAHECGHHA 111 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 25.4 bits (53), Expect = 8.8 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 179 CRHLVL*AMQEDCSRRSLGILHYCCPSCRSAVRRLREVK 295 CRH+ M C++ L CP CR V RL E+K Sbjct: 334 CRHM---CMCSGCAK-VLRFQTNRCPICRQPVERLLEIK 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,630,860 Number of Sequences: 28952 Number of extensions: 157657 Number of successful extensions: 459 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 360538848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -