BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0340 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 25 0.51 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 25 0.51 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.51 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 24 1.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 3.6 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 3.6 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 22 4.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.2 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 25.0 bits (52), Expect = 0.51 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 71 QSMPKIKPESFQKNNRICQTLQEDPYFEIDEVIG 172 + P P+ Q+ I TL+ P+F EV+G Sbjct: 448 EGYPHAVPKYIQRLKAIRATLKASPFFASHEVVG 481 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 25.0 bits (52), Expect = 0.51 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 71 QSMPKIKPESFQKNNRICQTLQEDPYFEIDEVIG 172 + P P+ Q+ I TL+ P+F EV+G Sbjct: 363 EGYPHAVPKYIQRLKAIRATLKASPFFASHEVVG 396 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.0 bits (52), Expect = 0.51 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 71 QSMPKIKPESFQKNNRICQTLQEDPYFEIDEVIG 172 + P P+ Q+ I TL+ P+F EV+G Sbjct: 682 EGYPHAVPKYIQRLKAIRATLKASPFFASHEVVG 715 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -2 Query: 337 Y*DV-RWRHSSSAGHQDTR 284 Y DV +W H+ S+G +DTR Sbjct: 9 YGDVYQWNHTVSSGERDTR 27 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 242 NATPKSFREYGTT 280 +A PK F+E+GTT Sbjct: 100 DALPKLFKEWGTT 112 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 3.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 511 SSLRETWSRGPVSVET*GGVQCAGSQLYFHHVP 413 SSL + RG T G + GS +FH P Sbjct: 603 SSLYGRFKRGKYEEPTVGEISQDGSSPHFHQSP 635 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 142 IFL*SLTYSIVFLETFRFYFG 80 +F+ SLT +IV +TF + G Sbjct: 9 LFILSLTITIVMCQTFTYSHG 29 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 224 YTFFRTSCSTCNRSSMASLSLHRFRNTDLPVK 129 Y +CST + ++ ++S+ R+ P+K Sbjct: 262 YIAMDVTCSTSSIFNLVAISIDRYIAVTQPIK 293 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,620 Number of Sequences: 438 Number of extensions: 4030 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -