BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0336 (498 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119558-1|AAM50212.1| 138|Drosophila melanogaster GM01181p pro... 72 5e-13 AE014134-2589|AAF53452.1| 138|Drosophila melanogaster CG15261-P... 72 5e-13 >AY119558-1|AAM50212.1| 138|Drosophila melanogaster GM01181p protein. Length = 138 Score = 71.7 bits (168), Expect = 5e-13 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 1/75 (1%) Frame = +2 Query: 254 ITSPEIYQPVGPYSQAILADKTLYISGILGXDRDA-QMVCGGAEAQTRQALDNLRHVLEA 430 I++ +PV PY+QA++AD+T+Y+SG LG D+D ++V GG Q ++AL+NL VL+A Sbjct: 9 ISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKA 68 Query: 431 GGASXESVVKTTVLL 475 + + V+K TV L Sbjct: 69 ADSGVDKVIKNTVFL 83 >AE014134-2589|AAF53452.1| 138|Drosophila melanogaster CG15261-PA protein. Length = 138 Score = 71.7 bits (168), Expect = 5e-13 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 1/75 (1%) Frame = +2 Query: 254 ITSPEIYQPVGPYSQAILADKTLYISGILGXDRDA-QMVCGGAEAQTRQALDNLRHVLEA 430 I++ +PV PY+QA++AD+T+Y+SG LG D+D ++V GG Q ++AL+NL VL+A Sbjct: 9 ISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKA 68 Query: 431 GGASXESVVKTTVLL 475 + + V+K TV L Sbjct: 69 ADSGVDKVIKNTVFL 83 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,014,844 Number of Sequences: 53049 Number of extensions: 386041 Number of successful extensions: 1038 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1763278080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -