BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0336 (498 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20390.1 68416.m02583 endoribonuclease L-PSP family protein c... 61 4e-10 At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein c... 38 0.004 At4g04920.1 68417.m00715 expressed protein 28 4.0 >At3g20390.1 68416.m02583 endoribonuclease L-PSP family protein contains Pfam domain PF01042: Endoribonuclease L-PSP Length = 187 Score = 61.3 bits (142), Expect = 4e-10 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%) Frame = +2 Query: 245 KNNITSPEIYQPVGPYSQAILADKTLYISGILGX-DRDAQMVCGGAEAQTRQALDNLRHV 421 K +++ + +GPYSQAI A+ +++SG+LG + V E QT Q L N+ + Sbjct: 64 KEVVSTEKAPAALGPYSQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEI 123 Query: 422 LEAGGASXESVVKTTVLL 475 L+A GA SVVKTT++L Sbjct: 124 LKASGADYSSVVKTTIML 141 >At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein contains Pfam domain PF01902: Domain of unknown function Length = 715 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 281 VGPYSQAILADKTLYISGILGXDRDA-QMVCGGAEAQTRQALDNLRHVLEAGGASXES 451 +GPYSQA L L+++G LG D + GA A+ QAL N + E+ S S Sbjct: 425 IGPYSQATLHQSVLHMAGQLGLDPPTMNLQTEGAIAELNQALTNSEAIAESFNCSISS 482 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 27.9 bits (59), Expect = 4.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 239 SNKNNITSPEIYQPVGPYSQAILADKTLYIS 331 SN+NN+TSP P + + DK+LY++ Sbjct: 844 SNRNNVTSP-TQNASSPATPQVFPDKSLYLA 873 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,728,535 Number of Sequences: 28952 Number of extensions: 184389 Number of successful extensions: 432 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -