BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0335 (555 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20390.1 68416.m02583 endoribonuclease L-PSP family protein c... 75 3e-14 At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein c... 42 2e-04 At4g04920.1 68417.m00715 expressed protein 28 4.8 At1g72870.1 68414.m08428 disease resistance protein (TIR-NBS cla... 27 8.4 >At3g20390.1 68416.m02583 endoribonuclease L-PSP family protein contains Pfam domain PF01042: Endoribonuclease L-PSP Length = 187 Score = 74.9 bits (176), Expect = 3e-14 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 1/95 (1%) Frame = +2 Query: 245 KNNITSPEIYQPVGPYSQAILADKTLYISGILGL-DRDAQMVCGGAEAQTRQALDNLRHV 421 K +++ + +GPYSQAI A+ +++SG+LGL + V E QT Q L N+ + Sbjct: 64 KEVVSTEKAPAALGPYSQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEI 123 Query: 422 LEAGGASLESVVKTTVLLASMDDFQTFNKSMQNIF 526 L+A GA SVVKTT++LA + DF+T N+ F Sbjct: 124 LKASGADYSSVVKTTIMLADLADFKTVNEIYAKYF 158 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 505 QIYAEYFPKACPARMTY 555 +IYA+YFP PAR TY Sbjct: 152 EIYAKYFPAPSPARSTY 168 >At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein contains Pfam domain PF01902: Domain of unknown function Length = 715 Score = 42.3 bits (95), Expect = 2e-04 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%) Frame = +2 Query: 281 VGPYSQAILADKTLYISGILGLDRDA-QMVCGGAEAQTRQALDNLRHVLEAGGASLESVV 457 +GPYSQA L L+++G LGLD + GA A+ QAL N + E+ S+ S Sbjct: 425 IGPYSQATLHQSVLHMAGQLGLDPPTMNLQTEGAIAELNQALTNSEAIAESFNCSISSSA 484 Query: 458 KTTVLLASMDDFQTFNKSMQNIFL 529 V+ S Q+ + F+ Sbjct: 485 ILFVVFCSARTKQSERNQLHEKFV 508 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 239 SNKNNITSPEIYQPVGPYSQAILADKTLYIS 331 SN+NN+TSP P + + DK+LY++ Sbjct: 844 SNRNNVTSP-TQNASSPATPQVFPDKSLYLA 873 >At1g72870.1 68414.m08428 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 512 Score = 27.1 bits (57), Expect = 8.4 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 1/85 (1%) Frame = +2 Query: 116 SFELLTYLHLKNKNELRRFCTGVRRQSFAQNEF-SKKFE*Q*SNKNNITSPEIYQPVGPY 292 S E +L + ++ R F + + R S Q E + KFE Q + S E+ Q + Sbjct: 7 SSEHKVFLSFRREDTGRTFVSHLYR-SLDQKEIRTYKFENQQAGDGKRISSEVKQAINES 65 Query: 293 SQAILADKTLYISGILGLDRDAQMV 367 A++ Y+S +L LD A+++ Sbjct: 66 RIAVVVISENYVSSVLCLDVLAKII 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,779,326 Number of Sequences: 28952 Number of extensions: 246007 Number of successful extensions: 638 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -