BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0333 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0387 - 2804990-2805059,2805106-2806086,2806856-2806875 31 0.51 11_06_0410 - 23223701-23223714,23223863-23225159,23225314-232262... 28 3.6 >02_01_0387 - 2804990-2805059,2805106-2806086,2806856-2806875 Length = 356 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 127 SSCSTCKW*CTESRGRSMGRSKNRRSS 207 +SC CK C S GRS R++ RRSS Sbjct: 252 TSCIFCKSFCRSSGGRSRARARERRSS 278 >11_06_0410 - 23223701-23223714,23223863-23225159,23225314-23226225, 23226952-23227023,23227323-23227471,23227879-23227912 Length = 825 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +2 Query: 374 SLFCHL*INKSKLIIQ--STLIHNATYGPSPVKQSGST 481 +LFCH I KSKL Q S N+T GPS ST Sbjct: 758 ALFCHCGIEKSKLWQQQKSANFRNSTPGPSNQSSDVST 795 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,474,691 Number of Sequences: 37544 Number of extensions: 128194 Number of successful extensions: 230 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 230 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -