Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0330
         (551 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2 prot...    24   0.77 
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    23   2.3  

>AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2
           protein.
          Length = 377

 Score = 24.2 bits (50), Expect = 0.77
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = +2

Query: 98  WTYPWKIRHSN*EDILRALAPRFQKKNHLRALRMICI 208
           W YP      N   +LR +   FQ K HL  + +  I
Sbjct: 145 WEYPEAKDKENFITLLREIKEAFQPKGHLLTIAVSAI 181


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 22.6 bits (46), Expect = 2.3
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +2

Query: 293 GFYTIRKRRKPY 328
           G  T+RK+RKPY
Sbjct: 239 GQVTVRKKRKPY 250


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,598
Number of Sequences: 336
Number of extensions: 2502
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13621010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)