BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0330 (551 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118924-1|AAM50784.1| 387|Drosophila melanogaster LD23767p pro... 131 7e-31 AE013599-1830|AAF58289.1| 387|Drosophila melanogaster CG8309-PA... 131 7e-31 AF517634-1|AAM77747.1| 4876|Drosophila melanogaster BIR-containi... 29 3.2 AE014297-1135|AAF54520.3| 4876|Drosophila melanogaster CG6303-PA... 29 3.2 >AY118924-1|AAM50784.1| 387|Drosophila melanogaster LD23767p protein. Length = 387 Score = 131 bits (316), Expect = 7e-31 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 2/135 (1%) Frame = +1 Query: 76 MQGPAVFMDISLEDQALELRRYFKSLGAEISEEKSPKGIEDDLHKIVGVCDACFK--EPS 249 M VF+D+SL++Q ELR+YFK LGAEIS EKS KG+EDDLHKI+GVCD CFK EPS Sbjct: 1 MTSHPVFIDLSLDEQVQELRKYFKKLGAEISSEKSNKGVEDDLHKIIGVCDVCFKDGEPS 60 Query: 250 ESTSKPF*TVLSLLWFLYH*KEEKTLS*HLVKGSLRLLGPKLGMVALQSLWRLYNNLEPN 429 + +++S++ + + E + + K + LG V LQSLWRL+NNL+ Sbjct: 61 Q-IDGILNSIVSIMITIPLDRGENIVLAYCEK-MTKAPNLPLGKVCLQSLWRLFNNLDTA 118 Query: 430 SPLRYHVYYHVIELA 474 SPLRYHVYYH++++A Sbjct: 119 SPLRYHVYYHLVQVA 133 >AE013599-1830|AAF58289.1| 387|Drosophila melanogaster CG8309-PA protein. Length = 387 Score = 131 bits (316), Expect = 7e-31 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 2/135 (1%) Frame = +1 Query: 76 MQGPAVFMDISLEDQALELRRYFKSLGAEISEEKSPKGIEDDLHKIVGVCDACFK--EPS 249 M VF+D+SL++Q ELR+YFK LGAEIS EKS KG+EDDLHKI+GVCD CFK EPS Sbjct: 1 MTSHPVFIDLSLDEQVQELRKYFKKLGAEISSEKSNKGVEDDLHKIIGVCDVCFKDGEPS 60 Query: 250 ESTSKPF*TVLSLLWFLYH*KEEKTLS*HLVKGSLRLLGPKLGMVALQSLWRLYNNLEPN 429 + +++S++ + + E + + K + LG V LQSLWRL+NNL+ Sbjct: 61 Q-IDGILNSIVSIMITIPLDRGENIVLAYCEK-MTKAPNLPLGKVCLQSLWRLFNNLDTA 118 Query: 430 SPLRYHVYYHVIELA 474 SPLRYHVYYH++++A Sbjct: 119 SPLRYHVYYHLVQVA 133 >AF517634-1|AAM77747.1| 4876|Drosophila melanogaster BIR-containing ubiquitin-conjugatingenzyme protein. Length = 4876 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +1 Query: 121 ALELRRYFKSLGAEISEEKSPKGIED 198 ++ LRR+++ L E+S+ K P+G+ED Sbjct: 4753 SMVLRRHYRHLREELSKLKPPRGLED 4778 >AE014297-1135|AAF54520.3| 4876|Drosophila melanogaster CG6303-PA protein. Length = 4876 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +1 Query: 121 ALELRRYFKSLGAEISEEKSPKGIED 198 ++ LRR+++ L E+S+ K P+G+ED Sbjct: 4753 SMVLRRHYRHLREELSKLKPPRGLED 4778 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,299,516 Number of Sequences: 53049 Number of extensions: 453036 Number of successful extensions: 1192 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2110522698 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -