BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0330 (551 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55369-1|AAK52175.1| 1247|Caenorhabditis elegans Cystic fibrosis... 29 1.7 Z75536-4|CAA99832.3| 2271|Caenorhabditis elegans Hypothetical pr... 28 5.1 Z75536-3|CAA99831.3| 2279|Caenorhabditis elegans Hypothetical pr... 28 5.1 U80028-7|AAG23984.1| 370|Caenorhabditis elegans Serpentine rece... 28 5.1 AF372457-1|AAK54248.1| 2279|Caenorhabditis elegans endocytosis p... 28 5.1 Z69717-2|CAA93532.2| 204|Caenorhabditis elegans Hypothetical pr... 27 6.8 Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical pr... 27 9.0 AL023810-4|CAD59138.1| 384|Caenorhabditis elegans Hypothetical ... 27 9.0 AL008881-3|CAD59164.1| 384|Caenorhabditis elegans Hypothetical ... 27 9.0 AL008881-1|CAA15517.2| 343|Caenorhabditis elegans Hypothetical ... 27 9.0 >U55369-1|AAK52175.1| 1247|Caenorhabditis elegans Cystic fibrosis transmembrane conductanceregulator homolog protein 1 protein. Length = 1247 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 100 DISLEDQALELRRYFKSLGAEISEEKSPKGIEDDLHKIVGVCDACFK 240 DI L +A +LR Y KSL + + SP+ + ++ V VC A K Sbjct: 1117 DIWLAIEACQLREYVKSLPDGLHQMVSPEKMSNEQKCQVNVCRALLK 1163 >Z75536-4|CAA99832.3| 2271|Caenorhabditis elegans Hypothetical protein F18C12.2b protein. Length = 2271 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 121 ALELRRYFKSLGAEISEEKSPKGIEDDLHKI 213 A++L Y K AE++ PK I DDL +I Sbjct: 1726 AIDLLDYIKKHSAELTGAPKPKAISDDLIEI 1756 >Z75536-3|CAA99831.3| 2279|Caenorhabditis elegans Hypothetical protein F18C12.2a protein. Length = 2279 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 121 ALELRRYFKSLGAEISEEKSPKGIEDDLHKI 213 A++L Y K AE++ PK I DDL +I Sbjct: 1726 AIDLLDYIKKHSAELTGAPKPKAISDDLIEI 1756 >U80028-7|AAG23984.1| 370|Caenorhabditis elegans Serpentine receptor, class w protein124 protein. Length = 370 Score = 27.9 bits (59), Expect = 5.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 83 PCILIPFLNCILLFIIYKH*SECK 12 PCIL+P + C+L+ + K +C+ Sbjct: 233 PCILLPIVTCLLVMDLLKTRKKCR 256 >AF372457-1|AAK54248.1| 2279|Caenorhabditis elegans endocytosis protein RME-8 protein. Length = 2279 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 121 ALELRRYFKSLGAEISEEKSPKGIEDDLHKI 213 A++L Y K AE++ PK I DDL +I Sbjct: 1726 AIDLLDYIKKHSAELTGAPKPKAISDDLIEI 1756 >Z69717-2|CAA93532.2| 204|Caenorhabditis elegans Hypothetical protein E01G6.2 protein. Length = 204 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 43 NKRIQFKKGIKMQGPAVFMDISLEDQALELRRYFKSLGAE 162 NK+ + K K G ++ MD+ LED+A L ++ G E Sbjct: 62 NKKTKVSKNGKDFGKSMSMDVLLEDEAAALVEALETFGDE 101 >Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical protein T28C6.9 protein. Length = 1861 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 103 ISLEDQALELRRYFKSLGAEISEEKSPK 186 +SLEDQ LEL + + E+ +EK+ K Sbjct: 1256 LSLEDQNLELEERLQEMEEELLDEKNKK 1283 >AL023810-4|CAD59138.1| 384|Caenorhabditis elegans Hypothetical protein Y9C2UA.1b protein. Length = 384 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 77 ILIPFLNCILLFIIYKH 27 +LIPFLN +++F+ Y H Sbjct: 170 LLIPFLNGLMIFLYYAH 186 >AL008881-3|CAD59164.1| 384|Caenorhabditis elegans Hypothetical protein Y9C2UA.1b protein. Length = 384 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 77 ILIPFLNCILLFIIYKH 27 +LIPFLN +++F+ Y H Sbjct: 170 LLIPFLNGLMIFLYYAH 186 >AL008881-1|CAA15517.2| 343|Caenorhabditis elegans Hypothetical protein Y9C2UA.1a protein. Length = 343 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 77 ILIPFLNCILLFIIYKH 27 +LIPFLN +++F+ Y H Sbjct: 129 LLIPFLNGLMIFLYYAH 145 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,025,368 Number of Sequences: 27780 Number of extensions: 232113 Number of successful extensions: 711 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -