BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0328 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 29 0.068 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 3.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 5.9 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 5.9 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 7.9 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 29.5 bits (63), Expect = 0.068 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = +2 Query: 218 RGSPTA*EGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 370 RG P +GG Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 114 RGVPFFGQGG-GQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.8 bits (49), Expect = 3.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 Query: 372 RPPRHMLPKAP*PDLWVPPPRTRGIRATARP 280 RPP H P W+ PP R +TA P Sbjct: 93 RPPWHPRPPFGGRPWWLRPPFHRPTTSTAAP 123 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 284 VRYPMIRHWFVTSLLLT 234 +RYP I HW LLT Sbjct: 2665 IRYPHILHWREMKALLT 2681 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.0 bits (47), Expect = 5.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 120 DGAGCSQAPPVRIQGAHTSGPG 185 DG +PP+ + G+ S PG Sbjct: 153 DGLHSIPSPPITVSGSDMSSPG 174 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 22.6 bits (46), Expect = 7.9 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -3 Query: 350 RRHPDRTYGYHHHGH 306 ++HP + +HHH H Sbjct: 175 QQHPGHSQHHHHHHH 189 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 517,908 Number of Sequences: 2352 Number of extensions: 11109 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -