BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0324 (556 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr 1|... 25 5.7 SPBP4H10.04 |ppb1||calcineurin catalytic subunit Ppb1|Schizosacc... 25 5.7 >SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 785 Score = 25.4 bits (53), Expect = 5.7 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 267 DAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMS 383 +AA+ + +V + + HI Q+I +LKY D+V++ S Sbjct: 116 EAAHRFLSSLVNSWKDHIV-SMQMISSVLKYLDKVYSKS 153 >SPBP4H10.04 |ppb1||calcineurin catalytic subunit Ppb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 25.4 bits (53), Expect = 5.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 276 NSIMGIVVENIEPHIHWKPQLID 344 N++M I N PH +W P +D Sbjct: 355 NNVMNIRQFNCSPHPYWLPNFMD 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,822,239 Number of Sequences: 5004 Number of extensions: 30419 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 231978230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -